Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1984
Gene name
LocationContig_16:13444..14527
Strand-
Gene length (bp)1083
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03690 UPF0160 Uncharacterised protein family (UPF0160) 5.0E-126 20 358

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O17606|YK4P_CAEEL UPF0160 protein C27H6.8 OS=Caenorhabditis elegans GN=C27H6.8 PE=3 SV=2 19 360 2.0E-92
sp|Q9HB07|MYG1_HUMAN UPF0160 protein MYG1, mitochondrial OS=Homo sapiens GN=C12orf10 PE=1 SV=2 12 359 5.0E-90
sp|Q641W2|MYG1_RAT UPF0160 protein MYG1, mitochondrial OS=Rattus norvegicus GN=Myg1 PE=1 SV=1 16 359 2.0E-89
sp|Q9JK81|MYG1_MOUSE UPF0160 protein MYG1, mitochondrial OS=Mus musculus GN=Myg1 PE=1 SV=1 16 359 3.0E-88
sp|Q55G91|U160_DICDI UPF0160 protein OS=Dictyostelium discoideum GN=DDB_G0267768 PE=3 SV=1 19 358 2.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O17606|YK4P_CAEEL UPF0160 protein C27H6.8 OS=Caenorhabditis elegans GN=C27H6.8 PE=3 SV=2 19 360 2.0E-92
sp|Q9HB07|MYG1_HUMAN UPF0160 protein MYG1, mitochondrial OS=Homo sapiens GN=C12orf10 PE=1 SV=2 12 359 5.0E-90
sp|Q641W2|MYG1_RAT UPF0160 protein MYG1, mitochondrial OS=Rattus norvegicus GN=Myg1 PE=1 SV=1 16 359 2.0E-89
sp|Q9JK81|MYG1_MOUSE UPF0160 protein MYG1, mitochondrial OS=Mus musculus GN=Myg1 PE=1 SV=1 16 359 3.0E-88
sp|Q55G91|U160_DICDI UPF0160 protein OS=Dictyostelium discoideum GN=DDB_G0267768 PE=3 SV=1 19 358 2.0E-87
sp|Q58DG1|MYG1_BOVIN UPF0160 protein MYG1, mitochondrial OS=Bos taurus PE=2 SV=1 16 359 2.0E-87
sp|P40093|YEY6_YEAST UPF0160 protein YER156C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER156C PE=1 SV=1 6 359 6.0E-83
sp|Q9P7T6|YIW4_SCHPO UPF0160 protein C694.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.04c PE=3 SV=1 20 358 9.0E-83
sp|Q9Z862|Y489_CHLPN UPF0160 protein CPn_0489/CP_0265/CPj0489/CpB0509 OS=Chlamydia pneumoniae GN=CPn_0489 PE=3 SV=2 20 341 2.0E-26
sp|O84391|Y386_CHLTR UPF0160 protein CT_386 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_386 PE=3 SV=2 20 341 9.0E-24
sp|Q9PK08|Y665_CHLMU UPF0160 protein TC_0665 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0665 PE=3 SV=2 20 341 2.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1984
MAESVAKRLKVSAQTAGPVIGTHNGYFHADEALAVYMLRMLPTYQHSPIVRTRDAAVLATCHTVVDVGGEYDAER
NRYDHHQRGFDVKFGGRQATKLSSAGLVFVHFGRAIVAQRMGEGVEQDAPQVGLVHDKLYQAFIEPLDAHDNGVA
VYDTQALAAAGVTKRFSDAGFSLAAMVSRLNGNWNDVRPDDAAESQRQEDACFMAASKRMGEEFERDLDYYVSAW
LPARAIVEQAYAQRHSVDARGRVLVFDAGAAAPPWKDHLFTLEEEQGAEAEPILYVLSPENANPGSKWRIQCVPV
AKDSFESRKPLPEAWRGLRDEELDAVAGIPGGVFVHNAGFVGGNKTFDGVKQMALKALAL*
Coding >OphauB2|1984
ATGGCTGAATCAGTGGCAAAGCGGCTCAAGGTATCCGCACAAACGGCGGGCCCCGTGATTGGCACGCACAATGGC
TACTTTCACGCCGACGAGGCCCTGGCCGTATACATGCTGCGCATGCTGCCGACATACCAGCACTCGCCCATTGTG
CGAACGCGCGATGCCGCGGTGCTGGCAACGTGCCACACCGTGGTTGACGTGGGCGGCGAGTACGACGCTGAGCGC
AACCGCTACGACCACCACCAGCGGGGCTTTGACGTCAAGTTTGGCGGCCGCCAAGCAACCAAGCTGTCGAGCGCA
GGCCTCGTCTTTGTGCACTTTGGCCGGGCAATTGTGGCGCAGCGCATGGGCGAGGGCGTGGAGCAGGATGCGCCG
CAGGTTGGCCTGGTGCACGACAAGCTCTACCAGGCCTTTATCGAGCCGCTCGATGCGCACGACAATGGTGTGGCC
GTCTATGACACGCAGGCGCTGGCGGCGGCGGGCGTGACGAAGCGGTTTAGCGACGCGGGCTTTTCCCTGGCTGCC
ATGGTGTCGCGCCTCAATGGCAACTGGAACGACGTGCGGCCCGACGATGCGGCAGAGAGCCAGCGCCAAGAGGAT
GCGTGCTTCATGGCTGCGAGCAAGCGCATGGGCGAGGAGTTTGAGCGCGATCTCGACTATTACGTTTCCGCCTGG
CTGCCTGCCCGCGCCATTGTCGAGCAGGCATACGCGCAGCGCCACAGCGTCGATGCTCGCGGCCGCGTCTTGGTC
TTTGATGCCGGCGCCGCTGCCCCGCCCTGGAAGGACCATCTCTTTACCCTCGAGGAGGAACAGGGCGCCGAAGCG
GAACCCATATTGTACGTCTTGAGCCCAGAGAATGCGAACCCGGGCTCAAAGTGGCGCATCCAGTGCGTGCCCGTT
GCCAAGGACTCGTTTGAGAGCCGCAAGCCGCTGCCCGAGGCGTGGCGCGGCCTGCGCGACGAGGAGCTCGATGCA
GTGGCCGGCATTCCGGGCGGCGTCTTTGTCCACAACGCGGGCTTTGTCGGCGGCAACAAGACGTTTGACGGCGTC
AAGCAAATGGCCCTCAAGGCACTCGCTCTATAA
Transcript >OphauB2|1984
ATGGCTGAATCAGTGGCAAAGCGGCTCAAGGTATCCGCACAAACGGCGGGCCCCGTGATTGGCACGCACAATGGC
TACTTTCACGCCGACGAGGCCCTGGCCGTATACATGCTGCGCATGCTGCCGACATACCAGCACTCGCCCATTGTG
CGAACGCGCGATGCCGCGGTGCTGGCAACGTGCCACACCGTGGTTGACGTGGGCGGCGAGTACGACGCTGAGCGC
AACCGCTACGACCACCACCAGCGGGGCTTTGACGTCAAGTTTGGCGGCCGCCAAGCAACCAAGCTGTCGAGCGCA
GGCCTCGTCTTTGTGCACTTTGGCCGGGCAATTGTGGCGCAGCGCATGGGCGAGGGCGTGGAGCAGGATGCGCCG
CAGGTTGGCCTGGTGCACGACAAGCTCTACCAGGCCTTTATCGAGCCGCTCGATGCGCACGACAATGGTGTGGCC
GTCTATGACACGCAGGCGCTGGCGGCGGCGGGCGTGACGAAGCGGTTTAGCGACGCGGGCTTTTCCCTGGCTGCC
ATGGTGTCGCGCCTCAATGGCAACTGGAACGACGTGCGGCCCGACGATGCGGCAGAGAGCCAGCGCCAAGAGGAT
GCGTGCTTCATGGCTGCGAGCAAGCGCATGGGCGAGGAGTTTGAGCGCGATCTCGACTATTACGTTTCCGCCTGG
CTGCCTGCCCGCGCCATTGTCGAGCAGGCATACGCGCAGCGCCACAGCGTCGATGCTCGCGGCCGCGTCTTGGTC
TTTGATGCCGGCGCCGCTGCCCCGCCCTGGAAGGACCATCTCTTTACCCTCGAGGAGGAACAGGGCGCCGAAGCG
GAACCCATATTGTACGTCTTGAGCCCAGAGAATGCGAACCCGGGCTCAAAGTGGCGCATCCAGTGCGTGCCCGTT
GCCAAGGACTCGTTTGAGAGCCGCAAGCCGCTGCCCGAGGCGTGGCGCGGCCTGCGCGACGAGGAGCTCGATGCA
GTGGCCGGCATTCCGGGCGGCGTCTTTGTCCACAACGCGGGCTTTGTCGGCGGCAACAAGACGTTTGACGGCGTC
AAGCAAATGGCCCTCAAGGCACTCGCTCTATAA
Gene >OphauB2|1984
ATGGCTGAATCAGTGGCAAAGCGGCTCAAGGTATCCGCACAAACGGCGGGCCCCGTGATTGGCACGCACAATGGC
TACTTTCACGCCGACGAGGCCCTGGCCGTATACATGCTGCGCATGCTGCCGACATACCAGCACTCGCCCATTGTG
CGAACGCGCGATGCCGCGGTGCTGGCAACGTGCCACACCGTGGTTGACGTGGGCGGCGAGTACGACGCTGAGCGC
AACCGCTACGACCACCACCAGCGGGGCTTTGACGTCAAGTTTGGCGGCCGCCAAGCAACCAAGCTGTCGAGCGCA
GGCCTCGTCTTTGTGCACTTTGGCCGGGCAATTGTGGCGCAGCGCATGGGCGAGGGCGTGGAGCAGGATGCGCCG
CAGGTTGGCCTGGTGCACGACAAGCTCTACCAGGCCTTTATCGAGCCGCTCGATGCGCACGACAATGGTGTGGCC
GTCTATGACACGCAGGCGCTGGCGGCGGCGGGCGTGACGAAGCGGTTTAGCGACGCGGGCTTTTCCCTGGCTGCC
ATGGTGTCGCGCCTCAATGGCAACTGGAACGACGTGCGGCCCGACGATGCGGCAGAGAGCCAGCGCCAAGAGGAT
GCGTGCTTCATGGCTGCGAGCAAGCGCATGGGCGAGGAGTTTGAGCGCGATCTCGACTATTACGTTTCCGCCTGG
CTGCCTGCCCGCGCCATTGTCGAGCAGGCATACGCGCAGCGCCACAGCGTCGATGCTCGCGGCCGCGTCTTGGTC
TTTGATGCCGGCGCCGCTGCCCCGCCCTGGAAGGACCATCTCTTTACCCTCGAGGAGGAACAGGGCGCCGAAGCG
GAACCCATATTGTACGTCTTGAGCCCAGAGAATGCGAACCCGGGCTCAAAGTGGCGCATCCAGTGCGTGCCCGTT
GCCAAGGACTCGTTTGAGAGCCGCAAGCCGCTGCCCGAGGCGTGGCGCGGCCTGCGCGACGAGGAGCTCGATGCA
GTGGCCGGCATTCCGGGCGGCGTCTTTGTCCACAACGCGGGCTTTGTCGGCGGCAACAAGACGTTTGACGGCGTC
AAGCAAATGGCCCTCAAGGCACTCGCTCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail