Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1970
Gene name
LocationContig_159:25991..26856
Strand+
Gene length (bp)865
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase 2.7E-33 33 124

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86ZF2|FKBP2_PODAS FK506-binding protein 2 OS=Podospora anserina GN=FPR2 PE=3 SV=1 19 175 1.0E-69
sp|O60046|FKBP2_NEUCR FK506-binding protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-5 PE=1 SV=1 1 175 2.0E-69
sp|Q4IN00|FKBP2_GIBZE FK506-binding protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FPR2 PE=3 SV=2 1 175 5.0E-69
sp|Q2UPT7|FKBP2_ASPOR FK506-binding protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr2 PE=3 SV=1 1 131 2.0E-54
sp|Q4WHX4|FKBP2_ASPFU FK506-binding protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr2 PE=3 SV=1 15 129 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86ZF2|FKBP2_PODAS FK506-binding protein 2 OS=Podospora anserina GN=FPR2 PE=3 SV=1 19 175 1.0E-69
sp|O60046|FKBP2_NEUCR FK506-binding protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-5 PE=1 SV=1 1 175 2.0E-69
sp|Q4IN00|FKBP2_GIBZE FK506-binding protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FPR2 PE=3 SV=2 1 175 5.0E-69
sp|Q2UPT7|FKBP2_ASPOR FK506-binding protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr2 PE=3 SV=1 1 131 2.0E-54
sp|Q4WHX4|FKBP2_ASPFU FK506-binding protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr2 PE=3 SV=1 15 129 5.0E-52
sp|Q5ATN7|FKBP2_EMENI FK506-binding protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fkbB PE=3 SV=1 1 131 1.0E-51
sp|P0CP96|FKBP2_CRYNJ FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR2 PE=3 SV=1 6 128 2.0E-42
sp|P0CP97|FKBP2_CRYNB FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR2 PE=3 SV=1 6 128 5.0E-42
sp|P20080|FKB1A_NEUCR FK506-binding protein 1A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-2 PE=1 SV=1 15 131 1.0E-40
sp|P0C1J5|FKB2B_RHIO9 FK506-binding protein 2B OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP3 PE=3 SV=1 6 140 2.0E-40
sp|Q6BP84|FKBP2_DEBHA FK506-binding protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR2 PE=3 SV=2 16 135 3.0E-36
sp|Q6CUZ8|FKBP2_KLULA FK506-binding protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FPR2 PE=3 SV=1 5 127 2.0E-35
sp|Q6FSC1|FKBP2_CANGA FK506-binding protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR2 PE=3 SV=1 9 126 7.0E-35
sp|Q54SR7|FKBP2_DICDI FK506-binding protein 2 OS=Dictyostelium discoideum GN=fkbp2 PE=3 SV=1 19 127 3.0E-34
sp|Q6CGG3|FKBP2_YARLI FK506-binding protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR2 PE=3 SV=1 11 127 5.0E-34
sp|Q41649|FKB15_VICFA FK506-binding protein 2 OS=Vicia faba GN=FKBP15 PE=1 SV=1 9 127 2.0E-32
sp|P45878|FKBP2_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Mus musculus GN=Fkbp2 PE=1 SV=1 5 127 3.0E-30
sp|P32472|FKBP2_YEAST Peptidyl-prolyl cis-trans isomerase FPR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR2 PE=1 SV=1 28 127 3.0E-30
sp|P26885|FKBP2_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens GN=FKBP2 PE=1 SV=2 5 127 4.0E-30
sp|Q32PA9|FKBP2_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Bos taurus GN=FKBP2 PE=2 SV=1 5 127 5.0E-30
sp|Q38935|FK151_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-1 OS=Arabidopsis thaliana GN=FKBP15-1 PE=2 SV=2 29 130 8.0E-30
sp|Q38936|FK152_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-2 OS=Arabidopsis thaliana GN=FKBP15-2 PE=2 SV=2 29 130 2.0E-28
sp|P59024|FKB14_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP14 OS=Mus musculus GN=Fkbp14 PE=1 SV=1 2 131 4.0E-28
sp|Q5R941|FKB14_PONAB Peptidyl-prolyl cis-trans isomerase FKBP14 OS=Pongo abelii GN=FKBP14 PE=2 SV=1 5 131 8.0E-27
sp|Q9NWM8|FKB14_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP14 OS=Homo sapiens GN=FKBP14 PE=1 SV=1 5 131 8.0E-27
sp|Q4WLV6|FKB1A_ASPFU FK506-binding protein 1A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr1A PE=3 SV=1 37 127 3.0E-25
sp|P28725|FKBP_STRAQ FK506-binding protein OS=Streptomyces anulatus GN=fkbP PE=1 SV=1 36 126 4.0E-23
sp|O42993|FKBP_SCHPO Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkh1 PE=3 SV=1 39 127 6.0E-23
sp|O54998|FKBP7_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP7 OS=Mus musculus GN=Fkbp7 PE=1 SV=1 29 131 7.0E-23
sp|Q554J3|FKBP1_DICDI FK506-binding protein 1 OS=Dictyostelium discoideum GN=fkbp1 PE=3 SV=1 39 124 9.0E-23
sp|Q9Z247|FKBP9_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Mus musculus GN=Fkbp9 PE=1 SV=1 15 124 1.0E-22
sp|Q5RET2|FKBP7_PONAB Peptidyl-prolyl cis-trans isomerase FKBP7 OS=Pongo abelii GN=FKBP7 PE=2 SV=1 5 131 1.0E-22
sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 31 129 1.0E-22
sp|Q66H94|FKBP9_RAT Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Rattus norvegicus GN=Fkbp9 PE=2 SV=1 15 124 3.0E-22
sp|P48375|FKB12_DROME 12 kDa FK506-binding protein OS=Drosophila melanogaster GN=FK506-bp2 PE=3 SV=2 37 127 3.0E-22
sp|P56989|FKBP_NEIMA FK506-binding protein OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbp PE=3 SV=1 38 124 5.0E-22
sp|Q2KJC8|FKBP9_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Bos taurus GN=FKBP9 PE=2 SV=1 28 124 6.0E-22
sp|Q66H94|FKBP9_RAT Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Rattus norvegicus GN=Fkbp9 PE=2 SV=1 3 126 7.0E-22
sp|Q9Z247|FKBP9_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Mus musculus GN=Fkbp9 PE=1 SV=1 3 126 1.0E-21
sp|O95302|FKBP9_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens GN=FKBP9 PE=1 SV=2 28 124 1.0E-21
sp|Q2U316|FKBP_ASPOR FK506-binding protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr1 PE=3 SV=1 38 127 1.0E-21
sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 39 124 1.0E-21
sp|Q6KBA8|FKB1A_EMENI FK506-binding protein 1A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fprA PE=3 SV=1 22 127 2.0E-21
sp|P20081|FKBP_YEAST FK506-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR1 PE=1 SV=2 37 127 2.0E-21
sp|P0C1J3|FKBP1_RHIO9 FK506-binding protein 1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP1 PE=3 SV=1 24 127 2.0E-21
sp|Q9SCY2|FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana GN=FKBP13 PE=1 SV=2 39 125 3.0E-21
sp|P0CP94|FKBP_CRYNJ FK506-binding protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR1 PE=3 SV=1 37 127 4.0E-21
sp|P0CP95|FKBP_CRYNB FK506-binding protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR1 PE=3 SV=1 37 127 4.0E-21
sp|P0A0W2|FKBP_NEIMB FK506-binding protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbp PE=1 SV=1 38 124 4.0E-21
sp|Q7SCN0|FKBP4_NEUCR FK506-binding protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-4 PE=3 SV=1 34 127 4.0E-21
sp|Q2YDL5|FKB11_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP11 OS=Bos taurus GN=FKBP11 PE=2 SV=1 21 126 5.0E-21
sp|Q9FLB3|FK153_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-3 OS=Arabidopsis thaliana GN=FKBP15-3 PE=2 SV=1 34 127 6.0E-21
sp|Q6FMA3|FKBP_CANGA FK506-binding protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR1 PE=3 SV=1 33 124 6.0E-21
sp|P0A0W3|FKBP_NEIMC FK506-binding protein OS=Neisseria meningitidis serogroup C GN=fbp PE=3 SV=1 38 124 7.0E-21
sp|O94746|FKBP_CRYNH FK506-binding protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=FRR1 PE=3 SV=1 37 127 9.0E-21
sp|Q2KJC8|FKBP9_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Bos taurus GN=FKBP9 PE=2 SV=1 28 126 2.0E-20
sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 39 128 2.0E-20
sp|Q6CF41|FKBP_YARLI FK506-binding protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR1 PE=3 SV=1 37 127 2.0E-20
sp|Q5RF88|FKBP5_PONAB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Pongo abelii GN=FKBP5 PE=2 SV=1 39 128 2.0E-20
sp|Q6CX30|FKBP_KLULA FK506-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FPR1 PE=3 SV=1 39 127 2.0E-20
sp|O95302|FKBP9_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens GN=FKBP9 PE=1 SV=2 12 126 3.0E-20
sp|Q61576|FKB10_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Mus musculus GN=Fkbp10 PE=1 SV=2 28 139 3.0E-20
sp|O42123|FKB1A_XENLA Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Xenopus laevis GN=fkbp1a PE=3 SV=3 22 127 3.0E-20
sp|Q9XSH5|FKBP5_SAIBB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saimiri boliviensis boliviensis GN=FKBP5 PE=1 SV=1 39 128 3.0E-20
sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 37 129 4.0E-20
sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens GN=FKBP10 PE=1 SV=1 28 126 5.0E-20
sp|Q61576|FKB10_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Mus musculus GN=Fkbp10 PE=1 SV=2 28 126 6.0E-20
sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 39 128 8.0E-20
sp|Q2HJ89|FKB10_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Bos taurus GN=FKBP10 PE=2 SV=1 28 139 8.0E-20
sp|Q4INZ9|FKBP4_GIBZE FK506-binding protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FPR4 PE=3 SV=1 34 127 1.0E-19
sp|P18203|FKB1A_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Bos taurus GN=FKBP1A PE=1 SV=2 22 127 1.0E-19
sp|P65764|FKBA_ECOL6 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fkpA PE=3 SV=1 37 133 1.0E-19
sp|P65765|FKBA_ECO57 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli O157:H7 GN=fkpA PE=3 SV=1 37 133 1.0E-19
sp|P62943|FKB1A_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Oryctolagus cuniculus GN=FKBP1A PE=1 SV=2 22 127 1.0E-19
sp|P62942|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens GN=FKBP1A PE=1 SV=2 22 127 1.0E-19
sp|Q754K8|FKBP_ASHGO FK506-binding protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FPR1 PE=3 SV=1 33 127 1.0E-19
sp|Q9XT11|FKBP5_AOTNA Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Aotus nancymaae GN=FKBP5 PE=2 SV=2 39 128 1.0E-19
sp|Q4WMV5|FKBP4_ASPFU FK506-binding protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr4 PE=3 SV=2 39 127 1.0E-19
sp|Q2HJ89|FKB10_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Bos taurus GN=FKBP10 PE=2 SV=1 28 126 2.0E-19
sp|P45523|FKBA_ECOLI FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli (strain K12) GN=fkpA PE=1 SV=1 37 133 2.0E-19
sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens GN=FKBP10 PE=1 SV=1 29 131 3.0E-19
sp|Q95L05|FKBP5_CHLAE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Chlorocebus aethiops GN=FKBP5 PE=2 SV=1 39 128 3.0E-19
sp|Q9D1M7|FKB11_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP11 OS=Mus musculus GN=Fkbp11 PE=1 SV=1 21 126 3.0E-19
sp|Q62658|FKB1A_RAT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Rattus norvegicus GN=Fkbp1a PE=1 SV=3 22 127 4.0E-19
sp|Q61576|FKB10_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Mus musculus GN=Fkbp10 PE=1 SV=2 24 131 5.0E-19
sp|Q2HJ89|FKB10_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Bos taurus GN=FKBP10 PE=2 SV=1 29 131 5.0E-19
sp|Q64378|FKBP5_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Mus musculus GN=Fkbp5 PE=1 SV=1 39 128 7.0E-19
sp|Q6BX45|FKBP_DEBHA FK506-binding protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR1 PE=3 SV=1 25 127 8.0E-19
sp|Q2UN37|FKBP4_ASPOR FK506-binding protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr4 PE=3 SV=1 39 127 9.0E-19
sp|Q9NYL4|FKB11_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP11 OS=Homo sapiens GN=FKBP11 PE=1 SV=1 21 126 1.0E-18
sp|Q89A61|FKBA_BUCBP FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fkpA PE=3 SV=1 37 127 2.0E-18
sp|P28870|FKBP_CANAL FK506-binding protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBP1 PE=3 SV=2 18 128 2.0E-18
sp|P68106|FKB1B_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo sapiens GN=FKBP1B PE=1 SV=2 37 127 2.0E-18
sp|P68107|FKB1B_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Bos taurus GN=FKBP1B PE=1 SV=2 37 127 2.0E-18
sp|P54397|FKB39_DROME 39 kDa FK506-binding nuclear protein OS=Drosophila melanogaster GN=FK506-bp1 PE=1 SV=2 37 123 2.0E-18
sp|Q4PIN7|FKBP4_USTMA FK506-binding protein 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FPR4 PE=3 SV=1 39 127 3.0E-18
sp|P97534|FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus GN=Fkbp1b PE=1 SV=3 37 127 3.0E-18
sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens GN=FKBP10 PE=1 SV=1 28 139 4.0E-18
sp|Q9Z2I2|FKB1B_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Mus musculus GN=Fkbp1b PE=1 SV=3 37 127 4.0E-18
sp|P0CP98|FKBP4_CRYNJ FK506-binding protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR4 PE=3 SV=1 37 126 4.0E-18
sp|P0CP99|FKBP4_CRYNB FK506-binding protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR4 PE=3 SV=1 37 126 4.0E-18
sp|P0C1B0|FKBP4_EMENI FK506-binding protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fpr4 PE=3 SV=2 38 127 5.0E-18
sp|O08437|FKBA_AERHY FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Aeromonas hydrophila GN=fkpA PE=3 SV=1 40 127 5.0E-18
sp|Q8HYX6|FKB1B_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Oryctolagus cuniculus GN=FKBP1B PE=3 SV=3 37 127 6.0E-18
sp|Q66H94|FKBP9_RAT Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Rattus norvegicus GN=Fkbp9 PE=2 SV=1 29 150 1.0E-17
sp|P26883|FKB1A_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus GN=Fkbp1a PE=1 SV=2 22 127 1.0E-17
sp|P0C1J4|FKB2A_RHIO9 FK506-binding protein 2A OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP2 PE=3 SV=1 11 127 1.0E-17
sp|Q9VL78|FKB59_DROME FK506-binding protein 59 OS=Drosophila melanogaster GN=FKBP59 PE=1 SV=1 37 128 2.0E-17
sp|Q9Z247|FKBP9_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Mus musculus GN=Fkbp9 PE=1 SV=1 29 150 3.0E-17
sp|P0C1J6|FKBP4_RHIO9 FK506-binding protein 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP4 PE=3 SV=1 37 127 4.0E-17
sp|Q93ZG9|FKB53_ARATH Peptidyl-prolyl cis-trans isomerase FKBP53 OS=Arabidopsis thaliana GN=FKBP53 PE=1 SV=1 39 127 4.0E-17
sp|Q2KJC8|FKBP9_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Bos taurus GN=FKBP9 PE=2 SV=1 29 150 6.0E-17
sp|O95302|FKBP9_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens GN=FKBP9 PE=1 SV=2 29 140 6.0E-17
sp|Q54G21|FKBP5_DICDI FK506-binding protein 5 OS=Dictyostelium discoideum GN=fkbp5 PE=1 SV=1 38 125 6.0E-17
sp|Q9Y680|FKBP7_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP7 OS=Homo sapiens GN=FKBP7 PE=1 SV=1 5 131 6.0E-17
sp|Q9Z247|FKBP9_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Mus musculus GN=Fkbp9 PE=1 SV=1 29 131 1.0E-16
sp|O95302|FKBP9_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens GN=FKBP9 PE=1 SV=2 29 131 1.0E-16
sp|Q6FKH7|FKBP3_CANGA FK506-binding protein 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR3 PE=3 SV=1 37 127 1.0E-16
sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 39 128 2.0E-16
sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 39 128 3.0E-16
sp|P42458|FKBP_CORGL Probable FK506-binding protein OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl0830 PE=3 SV=1 35 124 3.0E-16
sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 39 128 3.0E-16
sp|Q61576|FKB10_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Mus musculus GN=Fkbp10 PE=1 SV=2 29 130 4.0E-16
sp|Q8K943|FKBA_BUCAP FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fkpA PE=3 SV=1 35 129 4.0E-16
sp|O74191|FKBP4_SCHPO FK506-binding protein 39 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkbp39 PE=1 SV=1 38 126 4.0E-16
sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 39 128 5.0E-16
sp|Q4HZB8|FKBP_GIBZE FK506-binding protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FPR1 PE=3 SV=2 37 123 5.0E-16
sp|P57599|FKBA_BUCAI FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fkpA PE=3 SV=1 41 126 6.0E-16
sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 39 128 7.0E-16
sp|Q66H94|FKBP9_RAT Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Rattus norvegicus GN=Fkbp9 PE=2 SV=1 29 131 8.0E-16
sp|Q9M2S7|FK201_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-1 OS=Arabidopsis thaliana GN=FKBP20-1 PE=1 SV=1 42 124 8.0E-16
sp|Q06205|FKBP4_YEAST FK506-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR4 PE=1 SV=1 37 127 9.0E-16
sp|Q2KJC8|FKBP9_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Bos taurus GN=FKBP9 PE=2 SV=1 29 131 1.0E-15
sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 37 124 2.0E-15
sp|Q756V1|FKBP3_ASHGO FK506-binding protein 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FPR3 PE=3 SV=2 34 126 3.0E-15
sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens GN=FKBP10 PE=1 SV=1 32 130 5.0E-15
sp|P38911|FKBP3_YEAST FK506-binding nuclear protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR3 PE=1 SV=2 35 127 5.0E-15
sp|P0A9L4|FKBB_SHIFL FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase OS=Shigella flexneri GN=fklB PE=3 SV=2 40 126 5.0E-15
sp|P0A9L3|FKBB_ECOLI FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase OS=Escherichia coli (strain K12) GN=fklB PE=1 SV=2 40 126 5.0E-15
sp|O46638|FKBP3_RABIT Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Oryctolagus cuniculus GN=FKBP3 PE=2 SV=2 37 127 6.0E-15
sp|P26884|FKBP3_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Bos taurus GN=FKBP3 PE=1 SV=2 37 127 6.0E-15
sp|Q62446|FKBP3_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Mus musculus GN=Fkbp3 PE=1 SV=2 37 127 6.0E-15
sp|Q54N80|FKBP3_DICDI FK506-binding protein 3 OS=Dictyostelium discoideum GN=fkbp3 PE=2 SV=1 1 130 7.0E-15
sp|Q2HJ89|FKB10_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Bos taurus GN=FKBP10 PE=2 SV=1 29 130 1.0E-14
sp|Q00688|FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens GN=FKBP3 PE=1 SV=1 37 127 1.0E-14
sp|P44760|FKBY_HAEIN Probable FKBP-type peptidyl-prolyl cis-trans isomerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0574 PE=1 SV=1 40 134 1.0E-14
sp|Q4W9R2|FKB1B_ASPFU FK506-binding protein 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr1B PE=3 SV=1 37 127 1.0E-14
sp|Q9SCY3|PNSL4_ARATH Photosynthetic NDH subunit of lumenal location 4, chloroplastic OS=Arabidopsis thaliana GN=PNSL4 PE=1 SV=1 32 126 2.0E-14
sp|Q10175|FKBPH_SCHPO Probable peptidyl-prolyl cis-trans isomerase C27F1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27F1.06c PE=1 SV=1 41 126 2.0E-14
sp|Q6CWE8|FKBP3_KLULA FK506-binding protein 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FPR3 PE=3 SV=1 34 127 3.0E-14
sp|Q6FK71|FKBP4_CANGA FK506-binding protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR4 PE=3 SV=1 35 126 7.0E-14
sp|P51752|MIP_COXBU Peptidyl-prolyl cis-trans isomerase Mip OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mip PE=1 SV=2 17 127 4.0E-13
sp|Q6C4C9|FKBP3_YARLI FK506-binding protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR3 PE=3 SV=1 39 127 4.0E-13
sp|Q59VR3|FKBP3_CANAL FK506-binding protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FPR3 PE=3 SV=1 37 127 4.0E-13
sp|Q6BSE7|FKBP3_DEBHA FK506-binding protein 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR3 PE=3 SV=1 33 127 5.0E-13
sp|Q26486|FKBP4_SPOFR 46 kDa FK506-binding nuclear protein OS=Spodoptera frugiperda GN=FKBP46 PE=2 SV=1 39 127 1.0E-12
sp|F4J9Q6|FKB43_ARATH Peptidyl-prolyl cis-trans isomerase FKBP43 OS=Arabidopsis thaliana GN=FKBP43 PE=2 SV=1 39 126 1.0E-12
sp|P0C1J7|FKBP5_RHIO9 FK506-binding protein 5 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP5 PE=3 SV=1 42 159 3.0E-12
sp|Q5T1M5|FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens GN=FKBP15 PE=1 SV=2 39 123 1.0E-11
sp|Q6M981|FKB1B_NEUCR FK506-binding protein 1B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-3 PE=3 SV=2 39 127 8.0E-11
sp|Q6P9Q6|FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus GN=Fkbp15 PE=1 SV=2 37 123 1.0E-10
sp|O22870|FK163_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-3 PE=1 SV=2 39 129 4.0E-10
sp|O52980|FKBP_METTL FKBP-type peptidyl-prolyl cis-trans isomerase OS=Methanothermococcus thermolithotrophicus PE=1 SV=1 39 115 7.0E-10
sp|Q9Z7P3|MIP_CHLPN Peptidyl-prolyl cis-trans isomerase Mip OS=Chlamydia pneumoniae GN=mip PE=3 SV=1 44 124 1.0E-09
sp|P53605|MIP_LEGLO Outer membrane protein MIP OS=Legionella longbeachae GN=mip PE=3 SV=1 40 127 1.0E-09
sp|P0CY37|FKB1B_EMENI FK506-binding protein 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=FKBP3 PE=3 SV=1 37 119 1.0E-09
sp|O81864|FK171_ARATH Peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic OS=Arabidopsis thaliana GN=FKBP17-1 PE=2 SV=1 39 114 2.0E-09
sp|O04287|FKB12_VICFA Peptidyl-prolyl cis-trans isomerase FKBP12 OS=Vicia faba GN=FKBP12 PE=1 SV=1 39 124 2.0E-09
sp|P31106|MIP_TATMI Outer membrane protein MIP OS=Tatlockia micdadei GN=mip PE=3 SV=1 40 127 2.0E-09
sp|Q9SR70|FK164_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-4 PE=1 SV=1 38 130 5.0E-09
sp|Q0WRJ7|FK202_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic OS=Arabidopsis thaliana GN=FKBP20-2 PE=1 SV=1 37 131 5.0E-09
sp|O75344|FKBP6_HUMAN Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Homo sapiens GN=FKBP6 PE=1 SV=1 42 153 5.0E-09
sp|P26623|MIP_CHLTR Peptidyl-prolyl cis-trans isomerase Mip OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mip PE=3 SV=3 44 124 8.0E-09
sp|Q70YI1|MIP_LEGPN Outer membrane protein MIP OS=Legionella pneumophila GN=mip PE=1 SV=1 40 127 1.0E-08
sp|A5IGB8|MIP_LEGPC Outer membrane protein MIP OS=Legionella pneumophila (strain Corby) GN=mip PE=3 SV=1 40 127 1.0E-08
sp|Q5ZXE0|MIP_LEGPH Outer membrane protein MIP OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mip PE=1 SV=2 40 127 1.0E-08
sp|Q9PJK1|MIP_CHLMU Peptidyl-prolyl cis-trans isomerase Mip OS=Chlamydia muridarum (strain MoPn / Nigg) GN=mip PE=3 SV=2 44 124 2.0E-08
sp|P21863|FKBX_PSEFL Probable FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase OS=Pseudomonas fluorescens GN=yaaD PE=3 SV=1 30 118 3.0E-08
sp|Q75LS8|FKB9L_HUMAN Putative FK506-binding protein 9-like protein OS=Homo sapiens GN=FKBP9P1 PE=5 SV=1 81 131 4.0E-08
sp|A6QQ71|FKBP6_BOVIN Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Bos taurus GN=FKBP6 PE=2 SV=1 42 153 1.0E-07
sp|D3ZQF4|FKBP6_RAT Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Rattus norvegicus GN=Fkbp6 PE=3 SV=1 42 153 1.0E-07
sp|Q8LGG0|FKB12_ARATH Peptidyl-prolyl cis-trans isomerase FKBP12 OS=Arabidopsis thaliana GN=FKBP12 PE=1 SV=2 39 127 1.0E-07
sp|Q91XW8|FKBP6_MOUSE Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Mus musculus GN=Fkbp6 PE=1 SV=1 42 153 2.0E-07
sp|F6PHZ6|FKBP6_HORSE Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Equus caballus GN=FKBP6 PE=1 SV=2 42 153 2.0E-07
sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 61 126 3.0E-07
sp|Q9JYI8|FKBA_NEIMB Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Neisseria meningitidis serogroup B (strain MC58) GN=fkpA PE=1 SV=1 17 130 3.0E-07
sp|Q57726|FKBP1_METJA Putative FKBP-type peptidyl-prolyl cis-trans isomerase MJ0278 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0278 PE=3 SV=1 65 114 3.0E-07
sp|Q7DMA9|PAS1_ARATH Peptidyl-prolyl cis-trans isomerase PASTICCINO1 OS=Arabidopsis thaliana GN=PAS1 PE=1 SV=2 28 164 4.0E-07
sp|B6JGU6|TIG_OLICO Trigger factor OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=tig PE=3 SV=1 35 104 5.0E-07
sp|Q54Y27|FKBP6_DICDI FK506-binding protein 6 OS=Dictyostelium discoideum GN=fkbp6 PE=3 SV=1 42 124 5.0E-07
sp|Q2Y6I9|TIG_NITMU Trigger factor OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tig PE=3 SV=1 32 133 9.0E-07
sp|P30417|FKBZ_PSEAE Probable FKBP-type 25 kDa peptidyl-prolyl cis-trans isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fkl PE=3 SV=2 31 127 2.0E-06
sp|Q0AJI1|TIG_NITEC Trigger factor OS=Nitrosomonas eutropha (strain C91) GN=tig PE=3 SV=1 10 150 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016853 isomerase activity No
GO:0016859 cis-trans isomerase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1970
MKAPVLLWAVLASATVSLAEKLDVQVTLPVECDRKTQNGDRVSMHYKGTLASTGEKFDASYDRNQPLTFKLGSGH
VIKGWEQGLLDMCIGEKRTLTIPPELAYGKRAVGPIPSDSTLVFETELVGIEGVPKPDKIKTKSVGDSAAEKVAS
VAAEAVDAAKTLVADTDDISGHEEL*
Coding >OphauB2|1970
ATGAAAGCCCCTGTCCTTCTTTGGGCAGTCTTGGCCTCAGCCACCGTCAGCCTCGCCGAAAAGCTAGATGTCCAA
GTCACGTTGCCCGTTGAGTGCGATCGCAAGACCCAGAACGGCGACCGAGTCTCCATGCACTACAAAGGCACATTG
GCTAGTACAGGCGAAAAATTTGACGCTAGCTATGATAGGAACCAGCCCCTCACCTTCAAACTAGGGTCTGGCCAT
GTCATTAAAGGATGGGAACAGGGCTTGCTAGACATGTGCATCGGCGAAAAACGCACCTTGACTATTCCCCCAGAG
CTTGCCTACGGCAAGCGCGCCGTCGGTCCCATACCCTCAGACTCGACTCTCGTTTTCGAGACGGAGCTGGTGGGC
ATCGAGGGTGTTCCCAAGCCCGACAAAATCAAAACAAAGTCTGTCGGTGACAGCGCCGCCGAAAAGGTCGCCAGC
GTCGCCGCAGAAGCTGTTGACGCTGCCAAGACGCTAGTTGCCGACACCGACGACATCTCGGGTCACGAGGAGCTG
TAG
Transcript >OphauB2|1970
ATGAAAGCCCCTGTCCTTCTTTGGGCAGTCTTGGCCTCAGCCACCGTCAGCCTCGCCGAAAAGCTAGATGTCCAA
GTCACGTTGCCCGTTGAGTGCGATCGCAAGACCCAGAACGGCGACCGAGTCTCCATGCACTACAAAGGCACATTG
GCTAGTACAGGCGAAAAATTTGACGCTAGCTATGATAGGAACCAGCCCCTCACCTTCAAACTAGGGTCTGGCCAT
GTCATTAAAGGATGGGAACAGGGCTTGCTAGACATGTGCATCGGCGAAAAACGCACCTTGACTATTCCCCCAGAG
CTTGCCTACGGCAAGCGCGCCGTCGGTCCCATACCCTCAGACTCGACTCTCGTTTTCGAGACGGAGCTGGTGGGC
ATCGAGGGTGTTCCCAAGCCCGACAAAATCAAAACAAAGTCTGTCGGTGACAGCGCCGCCGAAAAGGTCGCCAGC
GTCGCCGCAGAAGCTGTTGACGCTGCCAAGACGCTAGTTGCCGACACCGACGACATCTCGGGTCACGAGGAGCTG
TAG
Gene >OphauB2|1970
ATGAAAGCCCCTGTCCTTCTTTGGGCAGTCTTGGCCTCAGCCACCGTCAGCCTCGCCGAAAAGCTAGATGTCCAA
GTCACGTTGCCCGTTGAGTGCGATCGCAAGACCCAGAACGGCGACCGAGTCTCCATGCACTACAAAGGCACATTG
GCTAGTACAGGCGAAAAATTTGACGCTAGTAAGTCGCCCATAGCTCACTGCCTCTTTGGTCCAACGTTCCCTCTG
TTCGCTGGCCGATCTGCACTGCCATCCAGGCGACAAGGCGTTCCTGGACAGGCCACAGGTTTTCATTGCTAATTG
ACATCAGGCTATGATAGGAACCAGCCCCTCACCTTCAAACTAGGGTCTGGCCATGTCATTAAAGGGTACGTCATT
GTGGCCCGATACTCAACATGACCGATAGAATAGGCCTTTGCTCACAGAAGGCATATTCAGATGGGAACAGGGCTT
GCTAGACATGTGCATCGGCGAAAAACGGTAGGCCTCGGTCGACTGTCTGCACATCCCATACTTTGTCACACTGAC
AAGTGCCTCGCAGCACCTTGACTATTCCCCCAGAGCTTGCCTACGGCAAGCGCGCCGTCGGTCCCATACCCTCAG
ACTCGACTCTCGGTAAGCTTCTTGTTGTCTTGTCAAGCTCTGTCTAGCTTTGGCCTATCTGCATAGCCACCTGAC
CGATGACGCCATAGTTTTCGAGACGGAGCTGGTGGGCATCGAGGGTGTTCCCAAGCCCGACAAAATCAAAACAAA
GTCTGTCGGTGACAGCGCCGCCGAAAAGGTCGCCAGCGTCGCCGCAGAAGCTGTTGACGCTGCCAAGACGCTAGT
TGCCGACACCGACGACATCTCGGGTCACGAGGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail