Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1966
Gene name
LocationContig_159:18557..19805
Strand-
Gene length (bp)1248
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06792 UPF0261 Uncharacterised protein family (UPF0261) 1.7E-159 3 408

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q893M2|Y1794_CLOTE UPF0261 protein CTC_01794 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_01794 PE=3 SV=2 4 407 7.0E-82
sp|A4FLF6|Y5696_SACEN UPF0261 protein SACE_5696 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5696 PE=3 SV=1 1 412 8.0E-81
sp|Q8ZAG3|Y3839_YERPE UPF0261 protein YPO3839/y0391/YP_3209 OS=Yersinia pestis GN=YPO3839 PE=3 SV=1 4 401 6.0E-75
sp|Q7WHB9|Y3289_BORBR UPF0261 protein BB3289 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB3289 PE=3 SV=1 4 405 2.0E-73
sp|Q7W9E3|Y1817_BORPA UPF0261 protein BPP1817 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP1817 PE=3 SV=1 4 405 2.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q893M2|Y1794_CLOTE UPF0261 protein CTC_01794 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_01794 PE=3 SV=2 4 407 7.0E-82
sp|A4FLF6|Y5696_SACEN UPF0261 protein SACE_5696 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5696 PE=3 SV=1 1 412 8.0E-81
sp|Q8ZAG3|Y3839_YERPE UPF0261 protein YPO3839/y0391/YP_3209 OS=Yersinia pestis GN=YPO3839 PE=3 SV=1 4 401 6.0E-75
sp|Q7WHB9|Y3289_BORBR UPF0261 protein BB3289 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB3289 PE=3 SV=1 4 405 2.0E-73
sp|Q7W9E3|Y1817_BORPA UPF0261 protein BPP1817 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP1817 PE=3 SV=1 4 405 2.0E-73
sp|Q7VYV4|Y1203_BORPE UPF0261 protein BP1203 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=BP1203 PE=3 SV=1 4 405 3.0E-72
sp|A8GL43|Y4740_SERP5 UPF0261 protein Spro_4740 OS=Serratia proteamaculans (strain 568) GN=Spro_4740 PE=3 SV=1 4 405 2.0E-71
sp|P55606|Y4OU_RHISN UPF0261 protein y4oU OS=Rhizobium sp. (strain NGR234) GN=NGR_a02150 PE=3 SV=1 1 400 5.0E-71
sp|Q981G1|Y9388_RHILO UPF0261 protein mll9388 OS=Rhizobium loti (strain MAFF303099) GN=mll9388 PE=3 SV=2 1 380 5.0E-70
sp|Q98GC6|Y3387_RHILO UPF0261 protein mlr3387 OS=Rhizobium loti (strain MAFF303099) GN=mlr3387 PE=3 SV=1 1 404 9.0E-64
sp|Q92YY3|Y4129_RHIME UPF0261 protein RA0729 OS=Rhizobium meliloti (strain 1021) GN=RA0729 PE=3 SV=1 1 404 1.0E-62
sp|Q8FUQ2|Y4168_BRUSU UPF0261 protein BRA1168/BS1330_II1159 OS=Brucella suis biovar 1 (strain 1330) GN=BRA1168 PE=3 SV=1 4 410 7.0E-35
sp|Q8YDP7|Y3128_BRUME UPF0261 protein BMEII0128 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEII0128 PE=3 SV=1 4 410 1.0E-33
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1966
MATVAIIATCDTKLQEILFLRDRIRSSNKVTTILIDVGRNPVSNDAIDISQEHLLSKHGGGQDVSQLPRAEVIEL
MSRCASDAVKNLFEQGVIDGIVAAGGSGGTTLASAIMRQVLPIGFPKLIVSTMASGDTGPIIGETDITLMYSVVD
VAGLNQILRDILTNAGAAIAGAALSFAERRCSEKRAPAQATKRVAISMFGVTTPGVDAIRNHLESKYPIETLVFH
ATGHGGKAMERLIQNGTIDAVVDLTTSEICDHLVGGQLSAGEQRLDAAVQAGIPNLVSLGAAEFANFGPLDSVPE
NFKSRLLHKHNSNVTLLRLSSYESEQVGNFICNKLLKSKRPNMVQIWVPKGGLSMLSVPGAPFADKDADEALFNA
IRKGLDGSGIEVIEDERDVNDQGFARDIAEAVATKIGLRG*
Coding >OphauB2|1966
ATGGCGACAGTGGCAATCATTGCAACTTGCGATACAAAATTGCAGGAGATTCTTTTCCTGCGCGATAGAATTCGA
TCCAGCAATAAAGTCACGACGATACTGATTGATGTCGGCCGAAACCCAGTCAGCAATGATGCTATTGACATATCT
CAGGAGCATCTGCTGTCGAAACACGGAGGCGGTCAAGACGTGTCCCAATTACCGAGGGCCGAAGTCATCGAGTTG
ATGTCTCGCTGTGCTTCCGATGCCGTCAAAAACCTCTTTGAACAGGGTGTCATTGATGGAATCGTCGCGGCAGGC
GGCTCTGGAGGAACCACGCTGGCGTCTGCAATCATGAGACAGGTGCTGCCCATAGGATTTCCCAAGCTCATTGTC
TCAACTATGGCGAGCGGAGATACTGGGCCTATAATCGGTGAGACGGACATTACGCTCATGTATTCAGTCGTCGAC
GTAGCTGGTCTGAACCAGATTTTGCGCGACATTCTCACCAATGCCGGGGCCGCCATTGCCGGTGCAGCGCTGTCG
TTTGCGGAGCGCAGATGCAGCGAGAAGCGAGCACCAGCTCAGGCTACAAAACGCGTGGCCATCTCCATGTTTGGC
GTCACAACTCCAGGCGTTGATGCCATTCGCAACCATCTCGAGTCCAAATATCCTATAGAAACATTGGTATTCCAC
GCGACTGGGCACGGCGGCAAGGCCATGGAGCGCCTTATCCAAAACGGGACAATTGACGCAGTTGTCGACCTGACC
ACTTCCGAGATATGCGATCACTTGGTAGGCGGCCAGCTGTCTGCAGGCGAGCAGAGGCTTGACGCCGCGGTGCAA
GCTGGCATCCCTAACCTCGTTTCCTTGGGAGCAGCTGAATTCGCCAACTTTGGCCCCCTTGACTCGGTTCCTGAA
AACTTCAAGAGCCGGCTCTTGCATAAGCATAATAGCAATGTAACGCTCTTGCGCTTGTCGTCATATGAGTCTGAG
CAAGTTGGAAACTTTATCTGCAACAAGCTGCTCAAGTCAAAAAGGCCCAACATGGTTCAAATATGGGTTCCAAAG
GGAGGTCTTAGTATGCTCTCTGTGCCTGGAGCACCCTTTGCCGACAAGGATGCCGACGAGGCACTCTTCAATGCT
ATCAGAAAAGGCCTGGACGGAAGCGGCATCGAGGTGATAGAAGATGAGAGAGACGTCAATGACCAAGGATTTGCA
CGAGACATTGCAGAGGCCGTGGCGACTAAGATTGGGCTAAGGGGTTAA
Transcript >OphauB2|1966
ATGGCGACAGTGGCAATCATTGCAACTTGCGATACAAAATTGCAGGAGATTCTTTTCCTGCGCGATAGAATTCGA
TCCAGCAATAAAGTCACGACGATACTGATTGATGTCGGCCGAAACCCAGTCAGCAATGATGCTATTGACATATCT
CAGGAGCATCTGCTGTCGAAACACGGAGGCGGTCAAGACGTGTCCCAATTACCGAGGGCCGAAGTCATCGAGTTG
ATGTCTCGCTGTGCTTCCGATGCCGTCAAAAACCTCTTTGAACAGGGTGTCATTGATGGAATCGTCGCGGCAGGC
GGCTCTGGAGGAACCACGCTGGCGTCTGCAATCATGAGACAGGTGCTGCCCATAGGATTTCCCAAGCTCATTGTC
TCAACTATGGCGAGCGGAGATACTGGGCCTATAATCGGTGAGACGGACATTACGCTCATGTATTCAGTCGTCGAC
GTAGCTGGTCTGAACCAGATTTTGCGCGACATTCTCACCAATGCCGGGGCCGCCATTGCCGGTGCAGCGCTGTCG
TTTGCGGAGCGCAGATGCAGCGAGAAGCGAGCACCAGCTCAGGCTACAAAACGCGTGGCCATCTCCATGTTTGGC
GTCACAACTCCAGGCGTTGATGCCATTCGCAACCATCTCGAGTCCAAATATCCTATAGAAACATTGGTATTCCAC
GCGACTGGGCACGGCGGCAAGGCCATGGAGCGCCTTATCCAAAACGGGACAATTGACGCAGTTGTCGACCTGACC
ACTTCCGAGATATGCGATCACTTGGTAGGCGGCCAGCTGTCTGCAGGCGAGCAGAGGCTTGACGCCGCGGTGCAA
GCTGGCATCCCTAACCTCGTTTCCTTGGGAGCAGCTGAATTCGCCAACTTTGGCCCCCTTGACTCGGTTCCTGAA
AACTTCAAGAGCCGGCTCTTGCATAAGCATAATAGCAATGTAACGCTCTTGCGCTTGTCGTCATATGAGTCTGAG
CAAGTTGGAAACTTTATCTGCAACAAGCTGCTCAAGTCAAAAAGGCCCAACATGGTTCAAATATGGGTTCCAAAG
GGAGGTCTTAGTATGCTCTCTGTGCCTGGAGCACCCTTTGCCGACAAGGATGCCGACGAGGCACTCTTCAATGCT
ATCAGAAAAGGCCTGGACGGAAGCGGCATCGAGGTGATAGAAGATGAGAGAGACGTCAATGACCAAGGATTTGCA
CGAGACATTGCAGAGGCCGTGGCGACTAAGATTGGGCTAAGGGGTTAA
Gene >OphauB2|1966
ATGGCGACAGTGGCAATCATTGCAACTTGCGATACAAAATTGCAGGAGATTCTTTTCCTGCGCGATAGAATTCGA
TCCAGCAATAAAGTCACGACGATACTGATTGATGTCGGCCGAAACCCAGTCAGCAATGATGCTATTGACATATCT
CAGGAGCATCTGCTGTCGAAACACGGAGGCGGTCAAGACGTGTCCCAATTACCGAGGGCCGAAGTCATCGAGTTG
ATGTCTCGCTGTGCTTCCGATGCCGTCAAAAACCTCTTTGAACAGGGTGTCATTGATGGAATCGTCGCGGCAGGC
GGCTCTGGAGGAACCACGCTGGCGTCTGCAATCATGAGACAGGTGCTGCCCATAGGATTTCCCAAGCTCATTGTC
TCAACTATGGCGAGCGGAGATACTGGGCCTATAATCGGTGAGACGGACATTACGCTCATGTATTCAGTCGTCGAC
GTAGCTGGTCTGAACCAGATTTTGCGCGACATTCTCACCAATGCCGGGGCCGCCATTGCCGGTGCAGCGCTGTCG
TTTGCGGAGCGCAGATGCAGCGAGAAGCGAGCACCAGCTCAGGCTACAAAACGCGTGGCCATCTCCATGTTTGGC
GTCACAACTCCAGGCGTTGATGCCATTCGCAACCATCTCGAGTCCAAATATCCTATAGAAACATTGGTATTCCAC
GCGACTGGGCACGGCGGCAAGGCCATGGAGCGCCTTATCCAAAACGGGACAATTGACGCAGTTGTCGACCTGACC
ACTTCCGAGATATGCGATCACTTGGTAGGCGGCCAGCTGTCTGCAGGCGAGCAGAGGCTTGACGCCGCGGTGCAA
GCTGGCATCCCTAACCTCGTTTCCTTGGGAGCAGCTGAATTCGCCAACTTTGGCCCCCTTGACTCGGTTCCTGAA
AACTTCAAGAGCCGGCTCTTGCATAAGCATAATAGCAATGTAACGCTCTTGCGCTTGTCGTCATATGAGTCTGAG
CAAGTTGGAAACTTTATCTGCAACAAGCTGCTCAAGTCAAAAAGGCCCAACATGGTTCAAATATGGGTTCCAAAG
GGAGGTCTTAGTATGCTCTCTGTGCCTGGAGCACCCTTTGCCGACAAGGATGCCGACGAGGCACTCTTCAATGCT
ATCAGAAAAGGCCTGGACGGAAGCGGCATCGAGGTGATAGAAGATGAGAGAGACGTCAATGACCAAGGATTTGCA
CGAGACATTGCAGAGGCCGTGGCGACTAAGATTGGGCTAAGGGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail