Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1955
Gene name
LocationContig_158:26903..28553
Strand-
Gene length (bp)1650
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 158 445 1.0E-16
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 127 452 1.0E-14
sp|O80560|IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=IP5P12 PE=1 SV=2 108 445 4.0E-13
sp|Q9SYK4|IP5PD_ARATH Type I inositol polyphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=IP5P13 PE=1 SV=1 115 445 6.0E-13
sp|Q2I6J1|SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio GN=inppl1a PE=2 SV=2 123 447 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 158 445 1.0E-16
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 127 452 1.0E-14
sp|O80560|IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=IP5P12 PE=1 SV=2 108 445 4.0E-13
sp|Q9SYK4|IP5PD_ARATH Type I inositol polyphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=IP5P13 PE=1 SV=1 115 445 6.0E-13
sp|Q2I6J1|SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio GN=inppl1a PE=2 SV=2 123 447 3.0E-11
sp|Q0WQ41|IP5P7_ARATH Type IV inositol polyphosphate 5-phosphatase 7 OS=Arabidopsis thaliana GN=IP5P7 PE=1 SV=1 95 438 2.0E-10
sp|O15357|SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens GN=INPPL1 PE=1 SV=2 125 447 3.0E-10
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 129 437 6.0E-10
sp|Q6P549|SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus GN=Inppl1 PE=1 SV=1 125 447 6.0E-10
sp|Q9WVR3|SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus GN=Inppl1 PE=1 SV=1 125 447 6.0E-10
sp|Q9SKB7|IP5PE_ARATH Type II inositol polyphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=IP5P14 PE=1 SV=1 115 445 7.0E-10
sp|Q9LR47|IP5P6_ARATH Type IV inositol polyphosphate 5-phosphatase 6 OS=Arabidopsis thaliana GN=IP5P6 PE=1 SV=2 127 438 2.0E-09
sp|Q2I6J0|SHP2B_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2B OS=Danio rerio GN=inppl1b PE=2 SV=1 139 447 3.0E-09
sp|Q8H0Z6|IP5P3_ARATH Type IV inositol polyphosphate 5-phosphatase 3 OS=Arabidopsis thaliana GN=IP5P3 PE=1 SV=1 122 401 5.0E-09
sp|Q9WVR1|INP5E_RAT 72 kDa inositol polyphosphate 5-phosphatase OS=Rattus norvegicus GN=Inpp5e PE=1 SV=2 284 458 1.0E-08
sp|Q8GTS0|IP5P4_ARATH Type I inositol polyphosphate 5-phosphatase 4 OS=Arabidopsis thaliana GN=IP5P4 PE=2 SV=1 121 447 2.0E-08
sp|Q9JII1|INP5E_MOUSE 72 kDa inositol polyphosphate 5-phosphatase OS=Mus musculus GN=Inpp5e PE=1 SV=1 284 458 3.0E-08
sp|Q9FUR2|IP5P2_ARATH Type I inositol polyphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 107 443 6.0E-08
sp|Q66GQ6|IP5P5_ARATH Type I inositol polyphosphate 5-phosphatase 5 OS=Arabidopsis thaliana GN=IP5P5 PE=2 SV=1 165 437 8.0E-08
sp|Q6P4S2|SHIP1_XENLA Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Xenopus laevis GN=inpp5d PE=2 SV=1 127 447 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 506 523 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1955
MSSSSLDLVVITFNCAKHLIDVGVFATHVQSVFEHKATSGLADVVVISLQEVGPLSQAFIGDYFLRAYLARFDEA
INLAAVQHCSEQDAKGSGASKGAGAGTGGGEHGGQETTSDTQAKAGRERKPYSLVKAHNVGFTAILLFARDPKRL
RNMEQAEVGFGTADMGSKGAVGLRMLYVVEATDTTRQQSTELTFVATHLAAMEWNLGLRNANWEAIMRGMTFKDP
MVFAQPGLSSSSSSSSSSSPCLPRSASAEEQHRLLQDERDERVQQQLRDVSIFKPSSYLFVAGDLNYRISTTSPG
PKAVFPSLDPESENYWPAFLPLDQLTREREAGRTLHGLTEHEVRFPPTYKYVVKQQQSATHRLLQWRQGAGSEHV
EESVDEQQLPCSFAPHRYPSWTDRILYLDLPSWVKARPDAPRITVHAYDALAVMRSSDHRPVYMRVNVPLVSPKD
MVPPPTGRVAETDSLDPRVQSPVDIDAEAWQRRRAARNKELVLGWTMFLWSTPEGTWTLAALLVAGLGAYWLYRT
V*
Coding >OphauB2|1955
ATGTCGTCTTCGAGTCTCGATCTGGTGGTGATTACGTTCAACTGCGCCAAGCATCTGATTGATGTTGGTGTTTTT
GCCACACACGTGCAATCGGTGTTTGAGCACAAGGCGACGAGTGGACTGGCTGATGTGGTTGTCATCTCACTGCAA
GAAGTTGGGCCGCTGAGCCAGGCCTTTATCGGCGACTACTTTCTCAGAGCGTACCTGGCGCGATTCGACGAGGCA
ATCAACCTTGCTGCGGTGCAGCATTGCAGCGAGCAAGACGCAAAGGGTAGCGGAGCGTCCAAGGGCGCTGGGGCT
GGGACGGGAGGCGGCGAACATGGCGGGCAAGAGACGACGAGTGACACGCAAGCCAAGGCTGGCCGGGAACGAAAG
CCGTACAGTTTGGTCAAGGCACACAACGTCGGCTTCACGGCCATCTTGCTGTTTGCCAGAGACCCGAAGCGGCTG
AGAAACATGGAGCAAGCAGAAGTGGGCTTTGGCACGGCCGACATGGGCAGCAAGGGCGCTGTGGGGCTGCGGATG
CTCTACGTGGTGGAAGCCACAGACACGACGAGGCAGCAGTCTACTGAGCTGACGTTTGTGGCGACGCATCTGGCG
GCCATGGAATGGAACTTGGGGCTTCGCAACGCCAACTGGGAGGCAATTATGCGCGGCATGACGTTTAAGGACCCC
ATGGTGTTTGCGCAGCCTGGGCTATCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCTCCTTGTTTGCCTCGGTCC
GCCTCGGCAGAGGAGCAGCACAGACTGCTGCAAGATGAGCGCGACGAGCGCGTCCAACAACAGCTGCGCGACGTG
TCCATTTTCAAGCCATCCTCATACCTCTTTGTTGCCGGAGACCTCAACTATCGCATCTCGACAACGTCACCGGGG
CCCAAGGCAGTATTTCCAAGTCTGGACCCCGAGTCGGAAAACTACTGGCCGGCCTTTTTGCCGCTAGACCAACTG
ACACGAGAGCGAGAGGCCGGAAGAACACTGCATGGGCTGACGGAGCACGAGGTTCGATTTCCGCCCACATACAAG
TACGTGGTGAAGCAGCAGCAGTCGGCAACACACAGGCTGTTGCAGTGGAGGCAAGGGGCGGGCAGCGAGCACGTA
GAAGAGTCTGTCGACGAGCAACAGCTGCCGTGCAGCTTTGCGCCGCATCGGTATCCGAGCTGGACGGACCGTATC
CTCTACCTCGACCTACCGTCTTGGGTCAAGGCACGACCCGATGCCCCGCGCATCACGGTACATGCCTACGACGCC
CTGGCTGTAATGAGAAGCAGCGATCACCGCCCCGTGTATATGCGCGTCAATGTGCCTCTAGTCTCGCCCAAGGAC
ATGGTGCCGCCGCCGACTGGGCGCGTGGCCGAGACTGACAGCCTAGATCCACGCGTGCAGTCTCCAGTTGACATT
GATGCAGAGGCGTGGCAGCGCCGCAGGGCTGCTCGGAACAAGGAGCTGGTGCTTGGATGGACCATGTTTCTCTGG
AGCACGCCCGAGGGCACCTGGACACTGGCAGCGCTTCTTGTTGCTGGACTCGGGGCCTATTGGCTTTATAGGACG
GTTTGA
Transcript >OphauB2|1955
ATGTCGTCTTCGAGTCTCGATCTGGTGGTGATTACGTTCAACTGCGCCAAGCATCTGATTGATGTTGGTGTTTTT
GCCACACACGTGCAATCGGTGTTTGAGCACAAGGCGACGAGTGGACTGGCTGATGTGGTTGTCATCTCACTGCAA
GAAGTTGGGCCGCTGAGCCAGGCCTTTATCGGCGACTACTTTCTCAGAGCGTACCTGGCGCGATTCGACGAGGCA
ATCAACCTTGCTGCGGTGCAGCATTGCAGCGAGCAAGACGCAAAGGGTAGCGGAGCGTCCAAGGGCGCTGGGGCT
GGGACGGGAGGCGGCGAACATGGCGGGCAAGAGACGACGAGTGACACGCAAGCCAAGGCTGGCCGGGAACGAAAG
CCGTACAGTTTGGTCAAGGCACACAACGTCGGCTTCACGGCCATCTTGCTGTTTGCCAGAGACCCGAAGCGGCTG
AGAAACATGGAGCAAGCAGAAGTGGGCTTTGGCACGGCCGACATGGGCAGCAAGGGCGCTGTGGGGCTGCGGATG
CTCTACGTGGTGGAAGCCACAGACACGACGAGGCAGCAGTCTACTGAGCTGACGTTTGTGGCGACGCATCTGGCG
GCCATGGAATGGAACTTGGGGCTTCGCAACGCCAACTGGGAGGCAATTATGCGCGGCATGACGTTTAAGGACCCC
ATGGTGTTTGCGCAGCCTGGGCTATCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCTCCTTGTTTGCCTCGGTCC
GCCTCGGCAGAGGAGCAGCACAGACTGCTGCAAGATGAGCGCGACGAGCGCGTCCAACAACAGCTGCGCGACGTG
TCCATTTTCAAGCCATCCTCATACCTCTTTGTTGCCGGAGACCTCAACTATCGCATCTCGACAACGTCACCGGGG
CCCAAGGCAGTATTTCCAAGTCTGGACCCCGAGTCGGAAAACTACTGGCCGGCCTTTTTGCCGCTAGACCAACTG
ACACGAGAGCGAGAGGCCGGAAGAACACTGCATGGGCTGACGGAGCACGAGGTTCGATTTCCGCCCACATACAAG
TACGTGGTGAAGCAGCAGCAGTCGGCAACACACAGGCTGTTGCAGTGGAGGCAAGGGGCGGGCAGCGAGCACGTA
GAAGAGTCTGTCGACGAGCAACAGCTGCCGTGCAGCTTTGCGCCGCATCGGTATCCGAGCTGGACGGACCGTATC
CTCTACCTCGACCTACCGTCTTGGGTCAAGGCACGACCCGATGCCCCGCGCATCACGGTACATGCCTACGACGCC
CTGGCTGTAATGAGAAGCAGCGATCACCGCCCCGTGTATATGCGCGTCAATGTGCCTCTAGTCTCGCCCAAGGAC
ATGGTGCCGCCGCCGACTGGGCGCGTGGCCGAGACTGACAGCCTAGATCCACGCGTGCAGTCTCCAGTTGACATT
GATGCAGAGGCGTGGCAGCGCCGCAGGGCTGCTCGGAACAAGGAGCTGGTGCTTGGATGGACCATGTTTCTCTGG
AGCACGCCCGAGGGCACCTGGACACTGGCAGCGCTTCTTGTTGCTGGACTCGGGGCCTATTGGCTTTATAGGACG
GTTTGA
Gene >OphauB2|1955
ATGTCGTCTTCGAGTCTCGATCTGGTGGTGATTACGTTCAACTGCGCCAAGCATCTGATTGATGTTGGTGTTTTT
GCCACACACGTGCAATCGGTGTTTGAGCACAAGGCGACGAGTGGACTGGCTGATGTGGTTGTCATGTAGGTGGCA
AGCTTTGACTTTTCTGGAGGAAGACAATGTGGCTAACAGTGCCTGACTGGACTTACAAGCTCACTGCAAGAAGTT
GGGCCGCTGAGCCAGGCCTTTATCGGCGACTACTTTCTCAGAGCGTACCTGGCGCGATTCGACGAGGCAATCAAC
CTTGCTGCGGTGCAGCATTGCAGCGAGCAAGACGCAAAGGGTAGCGGAGCGTCCAAGGGCGCTGGGGCTGGGACG
GGAGGCGGCGAACATGGCGGGCAAGAGACGACGAGTGACACGCAAGCCAAGGCTGGCCGGGAACGAAAGCCGTAC
AGTTTGGTCAAGGCACACAACGTCGGCTTCACGGCCATCTTGCTGTTTGCCAGAGACCCGAAGCGGCTGAGAAAC
ATGGAGCAAGCAGAAGTGGGCTTTGGCACGGCCGACATGGGCAGCAAGGGCGCTGTGGGGCTGCGGATGCTCTAC
GTGGTGGAAGCCACAGACACGACGAGGCAGCAGTCTACTGAGCTGACGTTTGTGGCGACGCATCTGGCGGCCATG
GAATGGAACTTGGGGCTTCGCAACGCCAACTGGGAGGCAATTATGCGCGGCATGACGTTTAAGGACCCCATGGTG
TTTGCGCAGCCTGGGCTATCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCTCCTTGTTTGCCTCGGTCCGCCTCG
GCAGAGGAGCAGCACAGACTGCTGCAAGATGAGCGCGACGAGCGCGTCCAACAACAGCTGCGCGACGTGTCCATT
TTCAAGCCATCCTCATACCTCTTTGTTGCCGGAGACCTCAACTATCGCATCTCGACAACGTCACCGGGGCCCAAG
GCAGTATTTCCAAGTCTGGACCCCGAGTCGGAAAACTACTGGCCGGCCTTTTTGCCGCTAGACCAACTGACACGA
GAGCGAGAGGCCGGAAGAACACTGCATGGGCTGACGGAGCACGAGGTTCGATTTCCGCCCACATACAAGTACGTG
GTGAAGCAGCAGCAGTCGGCAACACACAGGCTGTTGCAGTGGAGGCAAGGGGCGGGCAGCGAGCACGTAGAAGAG
TCTGTCGACGAGCAACAGCTGCCGTGCAGCTTTGCGCCGCATCGGTATCCGAGCTGGACGGACCGTATCCTCTAC
CTCGACCTACCGTCTTGGGTCAAGGCACGACCCGATGCCCCGCGCATCACGGTACATGCCTACGACGCCCTGGCT
GTAATGAGAAGCAGCGATCACCGCCCCGTGTATATGCGCGTCAATGTGCCTCTAGTCTCGCCCAAGGACATGGTG
CCGCCGCCGACTGGGCGCGTGGCCGAGACTGACAGCCTAGATCCACGCGTGCAGTCTCCAGTTGACATTGATGCA
GAGGCGTGGCAGCGCCGCAGGGCTGCTCGGAACAAGGAGCTGGTGCTTGGATGGACCATGTTTCTCTGGAGCACG
CCCGAGGGCACCTGGACACTGGCAGCGCTTCTTGTTGCTGGACTCGGGGCCTATTGGCTTTATAGGACGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail