Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1953
Gene name
LocationContig_158:21004..24411
Strand-
Gene length (bp)3407
Transcript length (bp)3354
Coding sequence length (bp)3354
Protein length (aa) 1118

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.7E-45 281 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 37 1011 0.0E+00
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 6 1116 0.0E+00
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 2 1007 2.0E-170
sp|O94711|GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp2 PE=3 SV=1 74 594 2.0E-98
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 239 588 3.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 37 1011 0.0E+00
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 6 1116 0.0E+00
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 2 1007 2.0E-170
sp|O94711|GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp2 PE=3 SV=1 74 594 2.0E-98
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 239 588 3.0E-69
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 239 588 5.0E-69
sp|A3KGB4|TBC8B_MOUSE TBC1 domain family member 8B OS=Mus musculus GN=Tbc1d8b PE=1 SV=1 238 593 1.0E-66
sp|Q9Z1A9|TBCD8_MOUSE TBC1 domain family member 8 OS=Mus musculus GN=Tbc1d8 PE=1 SV=2 218 588 2.0E-66
sp|Q0IIM8|TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens GN=TBC1D8B PE=1 SV=2 238 593 1.0E-65
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 215 588 2.0E-65
sp|B0R0W9|TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio GN=tbc1d8b PE=3 SV=1 37 585 3.0E-65
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 238 588 4.0E-65
sp|O95759|TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens GN=TBC1D8 PE=2 SV=3 217 588 6.0E-65
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 262 507 5.0E-41
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 262 507 7.0E-41
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 262 507 2.0E-40
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 262 507 1.0E-39
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 263 584 5.0E-39
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 209 580 3.0E-38
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 266 497 1.0E-36
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 264 565 5.0E-35
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 255 546 9.0E-35
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 251 503 6.0E-34
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 255 500 8.0E-34
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 251 503 1.0E-33
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 271 478 9.0E-33
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 271 478 1.0E-32
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 270 478 2.0E-32
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 270 478 2.0E-32
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 257 503 4.0E-32
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 274 499 9.0E-32
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 272 489 1.0E-31
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 275 479 3.0E-31
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda melanoleuca GN=TBC1D2 PE=3 SV=1 270 565 6.0E-30
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 237 498 4.0E-29
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 251 488 2.0E-28
sp|Q96CN4|EVI5L_HUMAN EVI5-like protein OS=Homo sapiens GN=EVI5L PE=1 SV=1 251 584 7.0E-28
sp|Q8BYJ6|TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus GN=Tbc1d4 PE=1 SV=2 258 499 9.0E-28
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 251 489 9.0E-28
sp|Q86TI0|TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens GN=TBC1D1 PE=1 SV=2 250 504 1.0E-27
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 266 493 2.0E-27
sp|Q60949|TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus GN=Tbc1d1 PE=1 SV=3 250 504 3.0E-27
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 251 489 4.0E-27
sp|O60447|EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens GN=EVI5 PE=1 SV=3 266 581 7.0E-27
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 251 487 1.0E-26
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 251 488 1.0E-26
sp|O97790|TBCD1_BOVIN TBC1 domain family member 1 OS=Bos taurus GN=TBC1D1 PE=2 SV=2 250 504 2.0E-26
sp|O60343|TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens GN=TBC1D4 PE=1 SV=2 238 511 2.0E-26
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 237 527 3.0E-26
sp|A6H6A9|RBG1L_MOUSE Rab GTPase-activating protein 1-like OS=Mus musculus GN=Rabgap1l PE=1 SV=1 237 493 3.0E-26
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musculus GN=Rabgap1 PE=1 SV=1 237 493 4.0E-26
sp|Q5RAN1|RBGP1_PONAB Rab GTPase-activating protein 1 OS=Pongo abelii GN=RABGAP1 PE=2 SV=1 237 493 6.0E-26
sp|Q9Y3P9|RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens GN=RABGAP1 PE=1 SV=3 237 493 8.0E-26
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 270 485 4.0E-25
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 270 485 7.0E-25
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 237 493 7.0E-25
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 237 493 9.0E-25
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 272 484 1.0E-23
sp|Q9VYY9|EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster GN=Evi5 PE=1 SV=3 251 494 1.0E-22
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 325 488 9.0E-22
sp|P97366|EVI5_MOUSE Ecotropic viral integration site 5 protein OS=Mus musculus GN=Evi5 PE=1 SV=2 266 581 2.0E-21
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 277 506 2.0E-20
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 277 493 5.0E-18
sp|Q28C33|TBC30_XENTR TBC1 domain family member 30 OS=Xenopus tropicalis GN=tbc1d30 PE=2 SV=1 276 497 8.0E-18
sp|Q10496|GYP51_SCHPO GTPase activating protein Gyp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp51 PE=3 SV=1 340 498 5.0E-17
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 274 497 9.0E-17
sp|Q69ZT9|TBC30_MOUSE TBC1 domain family member 30 OS=Mus musculus GN=Tbc1d30 PE=1 SV=2 274 484 2.0E-16
sp|Q0IHY4|TBC12_XENTR TBC1 domain family member 12 OS=Xenopus tropicalis GN=tbc1d12 PE=2 SV=1 277 485 9.0E-16
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 318 506 1.0E-15
sp|A6H7I8|TBC14_BOVIN TBC1 domain family member 14 OS=Bos taurus GN=TBC1D14 PE=2 SV=2 318 506 1.0E-15
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 238 501 2.0E-15
sp|Q6A039|TBC12_MOUSE TBC1 domain family member 12 OS=Mus musculus GN=Tbc1d12 PE=1 SV=2 277 485 2.0E-15
sp|O60347|TBC12_HUMAN TBC1 domain family member 12 OS=Homo sapiens GN=TBC1D12 PE=1 SV=3 277 485 3.0E-15
sp|Q5CD77|TBC14_RAT TBC1 domain family member 14 OS=Rattus norvegicus GN=Tbc1d14 PE=2 SV=2 318 479 3.0E-15
sp|Q8CGA2|TBC14_MOUSE TBC1 domain family member 14 OS=Mus musculus GN=Tbc1d14 PE=1 SV=2 318 479 3.0E-15
sp|Q09445|GRTP6_CAEEL Growth hormone-regulated TBC protein 6 OS=Caenorhabditis elegans GN=tbc-6 PE=3 SV=3 260 480 5.0E-15
sp|P0C7X1|TBC3H_HUMAN TBC1 domain family member 3H OS=Homo sapiens GN=TBC1D3H PE=2 SV=3 277 524 7.0E-14
sp|B9A6J9|TBC3L_HUMAN TBC1 domain family member 3L OS=Homo sapiens GN=TBC1D3L PE=2 SV=1 277 524 1.0E-13
sp|A0A087WVF3|TBC3D_HUMAN TBC1 domain family member 3D OS=Homo sapiens GN=TBC1D3D PE=2 SV=1 277 524 1.0E-13
sp|A0A087WXS9|TBC3I_HUMAN TBC1 domain family member 3I OS=Homo sapiens GN=TBC1D3I PE=3 SV=1 277 524 1.0E-13
sp|A0A087X179|TBC3E_HUMAN TBC1 domain family member 3E OS=Homo sapiens GN=TBC1D3E PE=2 SV=1 277 493 1.0E-13
sp|Q6DHY5|TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens GN=TBC1D3G PE=2 SV=2 277 524 2.0E-13
sp|Q8IZP1|TBC3A_HUMAN TBC1 domain family member 3 OS=Homo sapiens GN=TBC1D3 PE=1 SV=6 277 493 2.0E-13
sp|Q6IPX1|TBC3C_HUMAN TBC1 domain family member 3C OS=Homo sapiens GN=TBC1D3C PE=2 SV=3 277 493 2.0E-13
sp|A0A087X1G2|TBC3K_HUMAN TBC1 domain family member 3K OS=Homo sapiens GN=TBC1D3K PE=3 SV=1 277 493 4.0E-13
sp|A6NER0|TBC3F_HUMAN TBC1 domain family member 3F OS=Homo sapiens GN=TBC1D3F PE=2 SV=3 277 493 5.0E-13
sp|A6NDS4|TBC3B_HUMAN TBC1 domain family member 3B OS=Homo sapiens GN=TBC1D3B PE=2 SV=2 277 524 2.0E-12
sp|Q55EP9|BUB2_DICDI Putative mitotic check point protein BUB2 OS=Dictyostelium discoideum GN=bub2 PE=3 SV=1 282 465 3.0E-08
sp|Q55G97|TBCK_DICDI TBC domain-containing protein kinase-like protein OS=Dictyostelium discoideum GN=tbck PE=3 SV=1 265 451 5.0E-08
sp|O96904|TBC12_DICDI Drainin OS=Dictyostelium discoideum GN=phgA PE=1 SV=1 322 490 1.0E-07
sp|Q08CX5|TBC24_XENTR TBC1 domain family member 24 OS=Xenopus tropicalis GN=tbc1d24 PE=2 SV=1 282 560 7.0E-07
sp|Q29RJ2|TBC24_BOVIN TBC1 domain family member 24 OS=Bos taurus GN=TBC1D24 PE=2 SV=1 282 479 3.0E-06
sp|Q9ULP9|TBC24_HUMAN TBC1 domain family member 24 OS=Homo sapiens GN=TBC1D24 PE=1 SV=2 282 479 3.0E-06
sp|Q9Y7J5|YOI9_SCHPO TBC domain-containing protein C1778.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.09 PE=3 SV=1 345 487 6.0E-06
sp|Q3UUG6|TBC24_MOUSE TBC1 domain family member 24 OS=Mus musculus GN=Tbc1d24 PE=1 SV=2 282 479 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1953
MLSNLSSLVQKAQQLIDPTQGLNLSDSDRNPSKASLFQHQFRLPASQAPLCEIGAELTIPPSNATRGDRDHDRGW
HYAGRLHLSDSYLCFSTTPSSFSPSATSSSSLAFTGQTHGAGPSGNGFTFPLCAVRRVERLNSQTLQFALAITTW
NGLLVDASKDANHVRQQRITIHLAGSRSACERFCDGLKRGLRTGVAQVPKLRRLVADCYSEHLLRPDERKNASPP
DAGLGIMFRYPGDAKKLRDRAKMRLWAEYLRDNGRNATLIRQPTFHKLIRVGLPNRLRGEMWELTSGSLYLRLES
PTMYAETLAKFEGQESLAIDEIEKDLNRSLPEYPGFQSDEGIGRLRRVLTAYSWVNAQVGYCQAMNIVVAALLIY
MSETQAFFLLSVLCDRLVPGYYSTTMYGTLLDQKVFESLVEKTMPVLWEHLVKSDVQLSVVSLPWFLSLYVNSMP
LIFAFRVLDVFFVEGPKVLFQVGLAILRINGEELLDATDDGAFISVLKSYFARLDESAHPKSENPKLRAVTRFQE
LMVVAFKEFAAITHSSITEMRLRNKDAVLSNIESFAKRTAIRNLGPDSKLLATDELGALYDRFYSVLYERQQREQ
LVQEERKRRARTSKMRATDVFSSSSSSHSQVEKGRVALGSSTSLMDYDAFREFLAAMTRWAIADSPNNQSRRETA
AEADRLGKYHSTGNAPKAMSPWGCGPEPAEHDFLRRLYKKWDIDGQSALTLQNVVTGLAGIKGKRDIMGTITYFF
HLYDDDGDGKVDREGILRMSEALLFLSRRGLEGTLSPNASTTALSAEAPDSPAAGVPTNERFLGSVSAFIRRCFE
YADPDHPQNKTGQVEAADTSAFAIGDDDDDDDDLLGLDSPSPSPSPSKAVQDGKGGQDEAKDMKLAARRVSKAKS
EAANAALDPAHPLHITLPTFRMVVLADELLEQFFESSFPASFRVTQGVQGVAATTPTSSLTTFSSLGFGPRSPGL
LQSGPPGPPGRGLRGVLDNIVTDGMRVATEVRRRMEEAQKELDRHAVPGQRPDDDDDDDDDDAGAMLGHSRTSVG
RGAVSQDIERRSVKSTDRDLLDGLDAEAGVSSKEHDKSLLDTDDTEPHRQADAAVTDAGSAILEFEG*
Coding >OphauB2|1953
ATGCTGTCCAATCTGTCGAGCTTGGTGCAAAAGGCGCAGCAGCTCATCGACCCCACACAGGGCCTCAATCTCTCC
GACTCGGACCGCAACCCGTCCAAGGCGTCGCTCTTCCAGCATCAGTTCCGCCTGCCCGCCTCCCAGGCCCCGCTG
TGTGAGATTGGCGCCGAGCTGACCATCCCGCCCTCGAATGCCACGCGCGGAGATCGCGACCATGATCGCGGCTGG
CACTACGCTGGCCGCCTGCACCTGTCCGACTCGTACCTGTGCTTCTCCACCACGCCCTCGAGCTTCTCGCCCTCG
GCCACCTCGTCCTCTTCCCTCGCCTTTACCGGCCAGACGCACGGGGCCGGGCCTAGCGGCAATGGCTTCACCTTT
CCCCTCTGCGCCGTCCGCAGGGTCGAGAGGCTCAACAGCCAGACCTTGCAGTTTGCTCTTGCAATAACCACATGG
AACGGCCTGCTCGTCGACGCCTCCAAGGATGCGAACCATGTCCGCCAACAGCGCATCACAATACACTTGGCCGGC
TCCCGCTCAGCCTGCGAGCGCTTCTGCGACGGCCTCAAGAGGGGGCTGAGGACTGGCGTCGCCCAGGTGCCCAAG
CTGCGCCGCCTGGTGGCCGACTGCTACTCGGAGCACCTCTTGCGTCCCGACGAGCGCAAGAATGCAAGCCCGCCA
GATGCCGGCCTCGGCATCATGTTCCGCTATCCTGGAGACGCCAAGAAGCTCCGCGACCGGGCAAAGATGCGCCTG
TGGGCCGAGTATCTGCGCGACAATGGCCGCAACGCCACCCTGATTCGCCAGCCCACCTTTCACAAGCTCATCCGC
GTCGGCCTGCCCAACCGCCTTCGCGGCGAGATGTGGGAGCTCACCTCGGGCTCCCTCTACCTGCGCCTCGAGAGC
CCGACAATGTACGCCGAGACGCTAGCCAAGTTTGAGGGCCAAGAGTCCCTTGCCATTGACGAGATTGAAAAGGAT
CTCAACCGCAGCCTGCCCGAATACCCCGGCTTCCAGAGCGACGAGGGCATCGGCCGCCTGCGCCGCGTCTTGACC
GCCTACAGCTGGGTCAATGCCCAGGTGGGCTACTGCCAAGCCATGAACATTGTTGTCGCCGCTCTGCTCATCTAC
ATGTCGGAGACTCAGGCTTTTTTCCTGCTTTCTGTCCTGTGCGACCGCCTGGTGCCTGGCTACTACTCCACCACC
ATGTACGGCACTCTGCTCGATCAAAAGGTCTTTGAGTCCTTGGTGGAAAAGACGATGCCTGTCTTGTGGGAGCAC
CTGGTCAAGAGCGATGTCCAGCTCTCCGTCGTCTCCTTGCCCTGGTTTCTCTCCCTCTACGTCAACTCGATGCCC
CTCATCTTTGCCTTTCGCGTCCTCGACGTCTTTTTCGTCGAGGGACCCAAGGTCCTCTTCCAGGTCGGCCTGGCC
ATTCTGCGAATCAATGGCGAGGAGCTGCTCGACGCCACAGACGACGGGGCCTTCATCTCGGTCCTCAAGTCCTAC
TTTGCCCGGCTCGACGAGTCAGCCCACCCCAAGTCGGAGAATCCCAAGCTGCGGGCTGTCACGCGCTTCCAGGAG
CTCATGGTGGTGGCCTTTAAAGAGTTTGCGGCCATTACGCACAGCAGCATCACCGAGATGCGCCTGCGGAACAAG
GACGCCGTCCTGAGCAACATTGAAAGCTTTGCCAAGCGGACAGCCATCCGCAACCTTGGCCCCGACAGCAAGCTG
CTGGCCACGGATGAGCTGGGCGCTCTCTACGACCGCTTCTACAGCGTGCTCTATGAGCGCCAGCAGCGCGAGCAG
CTGGTGCAGGAGGAGCGCAAGCGGCGAGCCAGGACGAGCAAGATGCGGGCCACGGACGTCTTCTCCTCGTCCTCG
TCCTCGCACAGCCAGGTGGAGAAGGGCCGCGTCGCCCTCGGCTCCAGCACCAGCCTCATGGACTACGACGCCTTT
CGCGAGTTCCTGGCTGCAATGACCAGGTGGGCCATTGCAGACTCGCCCAACAACCAGTCGCGGCGTGAGACGGCC
GCCGAGGCGGACAGGCTTGGCAAGTACCATAGCACTGGAAATGCGCCCAAAGCCATGTCGCCATGGGGGTGTGGG
CCAGAGCCTGCCGAGCACGACTTTTTGCGCCGCCTGTACAAGAAGTGGGACATTGATGGCCAGTCGGCCCTGACG
CTGCAAAATGTGGTGACGGGGCTGGCGGGCATCAAGGGCAAGCGGGACATCATGGGCACCATTACCTATTTTTTC
CATCTCTATGACGACGACGGCGACGGCAAGGTGGACCGCGAAGGCATCTTGAGAATGTCCGAGGCCTTGCTCTTC
CTCTCGAGACGCGGGCTAGAGGGCACCCTGAGCCCCAATGCCTCTACCACGGCCCTCTCTGCCGAAGCTCCGGAT
TCACCAGCGGCCGGCGTGCCAACCAATGAGCGATTTCTGGGCAGCGTCAGTGCTTTTATTCGGCGCTGCTTCGAG
TATGCCGACCCGGACCATCCTCAGAACAAGACTGGCCAGGTCGAGGCAGCTGACACGAGTGCATTTGCCATTGGC
GACGACGACGACGACGACGACGACCTGTTGGGGCTGGATTCGCCGTCGCCGTCGCCGTCTCCCTCCAAGGCAGTT
CAAGACGGGAAAGGAGGGCAAGACGAGGCAAAGGACATGAAGCTTGCTGCTCGCAGAGTCTCCAAGGCCAAGTCT
GAGGCGGCCAACGCGGCGCTGGACCCAGCGCATCCTCTGCACATTACCCTGCCCACCTTTCGCATGGTTGTCCTG
GCCGATGAGCTGCTGGAGCAGTTTTTCGAGTCTTCGTTTCCCGCCTCGTTTCGTGTCACTCAAGGCGTGCAGGGC
GTGGCCGCCACGACTCCCACGTCGTCTCTCACCACCTTTTCCAGCTTGGGCTTCGGGCCAAGATCTCCAGGCTTG
TTGCAGAGCGGCCCGCCCGGGCCACCGGGCCGGGGTCTGCGCGGCGTGCTGGACAACATTGTGACGGACGGGATG
CGCGTGGCGACCGAGGTACGACGGCGCATGGAGGAAGCACAAAAGGAACTAGATAGGCATGCAGTGCCTGGCCAA
AGACCAGATGACGACGATGACGATGACGACGATGACGCGGGCGCCATGCTAGGGCACAGCAGGACAAGCGTTGGG
CGAGGCGCCGTCAGTCAGGACATTGAGCGGCGTTCAGTCAAGAGCACAGATCGCGATTTACTAGACGGGCTCGAT
GCCGAAGCTGGAGTCTCATCCAAGGAGCACGACAAGAGCCTCTTGGACACTGACGACACGGAGCCCCACCGCCAG
GCAGATGCTGCCGTAACAGACGCGGGCTCGGCCATCTTGGAATTTGAGGGATAA
Transcript >OphauB2|1953
ATGCTGTCCAATCTGTCGAGCTTGGTGCAAAAGGCGCAGCAGCTCATCGACCCCACACAGGGCCTCAATCTCTCC
GACTCGGACCGCAACCCGTCCAAGGCGTCGCTCTTCCAGCATCAGTTCCGCCTGCCCGCCTCCCAGGCCCCGCTG
TGTGAGATTGGCGCCGAGCTGACCATCCCGCCCTCGAATGCCACGCGCGGAGATCGCGACCATGATCGCGGCTGG
CACTACGCTGGCCGCCTGCACCTGTCCGACTCGTACCTGTGCTTCTCCACCACGCCCTCGAGCTTCTCGCCCTCG
GCCACCTCGTCCTCTTCCCTCGCCTTTACCGGCCAGACGCACGGGGCCGGGCCTAGCGGCAATGGCTTCACCTTT
CCCCTCTGCGCCGTCCGCAGGGTCGAGAGGCTCAACAGCCAGACCTTGCAGTTTGCTCTTGCAATAACCACATGG
AACGGCCTGCTCGTCGACGCCTCCAAGGATGCGAACCATGTCCGCCAACAGCGCATCACAATACACTTGGCCGGC
TCCCGCTCAGCCTGCGAGCGCTTCTGCGACGGCCTCAAGAGGGGGCTGAGGACTGGCGTCGCCCAGGTGCCCAAG
CTGCGCCGCCTGGTGGCCGACTGCTACTCGGAGCACCTCTTGCGTCCCGACGAGCGCAAGAATGCAAGCCCGCCA
GATGCCGGCCTCGGCATCATGTTCCGCTATCCTGGAGACGCCAAGAAGCTCCGCGACCGGGCAAAGATGCGCCTG
TGGGCCGAGTATCTGCGCGACAATGGCCGCAACGCCACCCTGATTCGCCAGCCCACCTTTCACAAGCTCATCCGC
GTCGGCCTGCCCAACCGCCTTCGCGGCGAGATGTGGGAGCTCACCTCGGGCTCCCTCTACCTGCGCCTCGAGAGC
CCGACAATGTACGCCGAGACGCTAGCCAAGTTTGAGGGCCAAGAGTCCCTTGCCATTGACGAGATTGAAAAGGAT
CTCAACCGCAGCCTGCCCGAATACCCCGGCTTCCAGAGCGACGAGGGCATCGGCCGCCTGCGCCGCGTCTTGACC
GCCTACAGCTGGGTCAATGCCCAGGTGGGCTACTGCCAAGCCATGAACATTGTTGTCGCCGCTCTGCTCATCTAC
ATGTCGGAGACTCAGGCTTTTTTCCTGCTTTCTGTCCTGTGCGACCGCCTGGTGCCTGGCTACTACTCCACCACC
ATGTACGGCACTCTGCTCGATCAAAAGGTCTTTGAGTCCTTGGTGGAAAAGACGATGCCTGTCTTGTGGGAGCAC
CTGGTCAAGAGCGATGTCCAGCTCTCCGTCGTCTCCTTGCCCTGGTTTCTCTCCCTCTACGTCAACTCGATGCCC
CTCATCTTTGCCTTTCGCGTCCTCGACGTCTTTTTCGTCGAGGGACCCAAGGTCCTCTTCCAGGTCGGCCTGGCC
ATTCTGCGAATCAATGGCGAGGAGCTGCTCGACGCCACAGACGACGGGGCCTTCATCTCGGTCCTCAAGTCCTAC
TTTGCCCGGCTCGACGAGTCAGCCCACCCCAAGTCGGAGAATCCCAAGCTGCGGGCTGTCACGCGCTTCCAGGAG
CTCATGGTGGTGGCCTTTAAAGAGTTTGCGGCCATTACGCACAGCAGCATCACCGAGATGCGCCTGCGGAACAAG
GACGCCGTCCTGAGCAACATTGAAAGCTTTGCCAAGCGGACAGCCATCCGCAACCTTGGCCCCGACAGCAAGCTG
CTGGCCACGGATGAGCTGGGCGCTCTCTACGACCGCTTCTACAGCGTGCTCTATGAGCGCCAGCAGCGCGAGCAG
CTGGTGCAGGAGGAGCGCAAGCGGCGAGCCAGGACGAGCAAGATGCGGGCCACGGACGTCTTCTCCTCGTCCTCG
TCCTCGCACAGCCAGGTGGAGAAGGGCCGCGTCGCCCTCGGCTCCAGCACCAGCCTCATGGACTACGACGCCTTT
CGCGAGTTCCTGGCTGCAATGACCAGGTGGGCCATTGCAGACTCGCCCAACAACCAGTCGCGGCGTGAGACGGCC
GCCGAGGCGGACAGGCTTGGCAAGTACCATAGCACTGGAAATGCGCCCAAAGCCATGTCGCCATGGGGGTGTGGG
CCAGAGCCTGCCGAGCACGACTTTTTGCGCCGCCTGTACAAGAAGTGGGACATTGATGGCCAGTCGGCCCTGACG
CTGCAAAATGTGGTGACGGGGCTGGCGGGCATCAAGGGCAAGCGGGACATCATGGGCACCATTACCTATTTTTTC
CATCTCTATGACGACGACGGCGACGGCAAGGTGGACCGCGAAGGCATCTTGAGAATGTCCGAGGCCTTGCTCTTC
CTCTCGAGACGCGGGCTAGAGGGCACCCTGAGCCCCAATGCCTCTACCACGGCCCTCTCTGCCGAAGCTCCGGAT
TCACCAGCGGCCGGCGTGCCAACCAATGAGCGATTTCTGGGCAGCGTCAGTGCTTTTATTCGGCGCTGCTTCGAG
TATGCCGACCCGGACCATCCTCAGAACAAGACTGGCCAGGTCGAGGCAGCTGACACGAGTGCATTTGCCATTGGC
GACGACGACGACGACGACGACGACCTGTTGGGGCTGGATTCGCCGTCGCCGTCGCCGTCTCCCTCCAAGGCAGTT
CAAGACGGGAAAGGAGGGCAAGACGAGGCAAAGGACATGAAGCTTGCTGCTCGCAGAGTCTCCAAGGCCAAGTCT
GAGGCGGCCAACGCGGCGCTGGACCCAGCGCATCCTCTGCACATTACCCTGCCCACCTTTCGCATGGTTGTCCTG
GCCGATGAGCTGCTGGAGCAGTTTTTCGAGTCTTCGTTTCCCGCCTCGTTTCGTGTCACTCAAGGCGTGCAGGGC
GTGGCCGCCACGACTCCCACGTCGTCTCTCACCACCTTTTCCAGCTTGGGCTTCGGGCCAAGATCTCCAGGCTTG
TTGCAGAGCGGCCCGCCCGGGCCACCGGGCCGGGGTCTGCGCGGCGTGCTGGACAACATTGTGACGGACGGGATG
CGCGTGGCGACCGAGGTACGACGGCGCATGGAGGAAGCACAAAAGGAACTAGATAGGCATGCAGTGCCTGGCCAA
AGACCAGATGACGACGATGACGATGACGACGATGACGCGGGCGCCATGCTAGGGCACAGCAGGACAAGCGTTGGG
CGAGGCGCCGTCAGTCAGGACATTGAGCGGCGTTCAGTCAAGAGCACAGATCGCGATTTACTAGACGGGCTCGAT
GCCGAAGCTGGAGTCTCATCCAAGGAGCACGACAAGAGCCTCTTGGACACTGACGACACGGAGCCCCACCGCCAG
GCAGATGCTGCCGTAACAGACGCGGGCTCGGCCATCTTGGAATTTGAGGGATAA
Gene >OphauB2|1953
ATGCTGTCCAATCTGTCGAGCTTGGTGCAAAAGGCGCAGCAGCTCATCGACCCCACACAGGGCCTCAATCTCTCC
GACTCGGACCGCAACCCGTCCAAGGCGTCGCTCTTCCAGCATCAGTTCCGCCTGCCCGCCTCCCAGGCCCCGCTG
TGTGAGATTGGCGCCGAGCTGACCATCCCGCCCTCGAATGCCACGCGCGGAGATCGCGACCATGATCGCGGCTGG
CACTACGCTGGCCGCCTGCACCTGTCCGACTCGTACCTGTGCTTCTCCACCACGCCCTCGAGCTTCTCGCCCTCG
GCCACCTCGTCCTCTTCCCTCGCCTTTACCGGCCAGACGCACGGGGCCGGGCCTAGCGGCAATGGCTTCACCTTT
CCCCTCTGCGCCGTCCGCAGGGTCGAGAGGCTCAACAGCCAGACCTTGCAGGCCAGTTTGCAAGGCCCTCGCCTG
TGCTGTCTCCAGCTAACACGCGCCCACAGTTTGCTCTTGCAATAACCACATGGAACGGCCTGCTCGTCGACGCCT
CCAAGGATGCGAACCATGTCCGCCAACAGCGCATCACAATACACTTGGCCGGCTCCCGCTCAGCCTGCGAGCGCT
TCTGCGACGGCCTCAAGAGGGGGCTGAGGACTGGCGTCGCCCAGGTGCCCAAGCTGCGCCGCCTGGTGGCCGACT
GCTACTCGGAGCACCTCTTGCGTCCCGACGAGCGCAAGAATGCAAGCCCGCCAGATGCCGGCCTCGGCATCATGT
TCCGCTATCCTGGAGACGCCAAGAAGCTCCGCGACCGGGCAAAGATGCGCCTGTGGGCCGAGTATCTGCGCGACA
ATGGCCGCAACGCCACCCTGATTCGCCAGCCCACCTTTCACAAGCTCATCCGCGTCGGCCTGCCCAACCGCCTTC
GCGGCGAGATGTGGGAGCTCACCTCGGGCTCCCTCTACCTGCGCCTCGAGAGCCCGACAATGTACGCCGAGACGC
TAGCCAAGTTTGAGGGCCAAGAGTCCCTTGCCATTGACGAGATTGAAAAGGATCTCAACCGCAGCCTGCCCGAAT
ACCCCGGCTTCCAGAGCGACGAGGGCATCGGCCGCCTGCGCCGCGTCTTGACCGCCTACAGCTGGGTCAATGCCC
AGGTGGGCTACTGCCAAGCCATGAACATTGTTGTCGCCGCTCTGCTCATCTACATGTCGGAGACTCAGGCTTTTT
TCCTGCTTTCTGTCCTGTGCGACCGCCTGGTGCCTGGCTACTACTCCACCACCATGTACGGCACTCTGCTCGATC
AAAAGGTCTTTGAGTCCTTGGTGGAAAAGACGATGCCTGTCTTGTGGGAGCACCTGGTCAAGAGCGATGTCCAGC
TCTCCGTCGTCTCCTTGCCCTGGTTTCTCTCCCTCTACGTCAACTCGATGCCCCTCATCTTTGCCTTTCGCGTCC
TCGACGTCTTTTTCGTCGAGGGACCCAAGGTCCTCTTCCAGGTCGGCCTGGCCATTCTGCGAATCAATGGCGAGG
AGCTGCTCGACGCCACAGACGACGGGGCCTTCATCTCGGTCCTCAAGTCCTACTTTGCCCGGCTCGACGAGTCAG
CCCACCCCAAGTCGGAGAATCCCAAGCTGCGGGCTGTCACGCGCTTCCAGGAGCTCATGGTGGTGGCCTTTAAAG
AGTTTGCGGCCATTACGCACAGCAGCATCACCGAGATGCGCCTGCGGAACAAGGACGCCGTCCTGAGCAACATTG
AAAGCTTTGCCAAGCGGACAGCCATCCGCAACCTTGGCCCCGACAGCAAGCTGCTGGCCACGGATGAGCTGGGCG
CTCTCTACGACCGCTTCTACAGCGTGCTCTATGAGCGCCAGCAGCGCGAGCAGCTGGTGCAGGAGGAGCGCAAGC
GGCGAGCCAGGACGAGCAAGATGCGGGCCACGGACGTCTTCTCCTCGTCCTCGTCCTCGCACAGCCAGGTGGAGA
AGGGCCGCGTCGCCCTCGGCTCCAGCACCAGCCTCATGGACTACGACGCCTTTCGCGAGTTCCTGGCTGCAATGA
CCAGGTGGGCCATTGCAGACTCGCCCAACAACCAGTCGCGGCGTGAGACGGCCGCCGAGGCGGACAGGCTTGGCA
AGTACCATAGCACTGGAAATGCGCCCAAAGCCATGTCGCCATGGGGGTGTGGGCCAGAGCCTGCCGAGCACGACT
TTTTGCGCCGCCTGTACAAGAAGTGGGACATTGATGGCCAGTCGGCCCTGACGCTGCAAAATGTGGTGACGGGGC
TGGCGGGCATCAAGGGCAAGCGGGACATCATGGGCACCATTACCTATTTTTTCCATCTCTATGACGACGACGGCG
ACGGCAAGGTGGACCGCGAAGGCATCTTGAGAATGTCCGAGGCCTTGCTCTTCCTCTCGAGACGCGGGCTAGAGG
GCACCCTGAGCCCCAATGCCTCTACCACGGCCCTCTCTGCCGAAGCTCCGGATTCACCAGCGGCCGGCGTGCCAA
CCAATGAGCGATTTCTGGGCAGCGTCAGTGCTTTTATTCGGCGCTGCTTCGAGTATGCCGACCCGGACCATCCTC
AGAACAAGACTGGCCAGGTCGAGGCAGCTGACACGAGTGCATTTGCCATTGGCGACGACGACGACGACGACGACG
ACCTGTTGGGGCTGGATTCGCCGTCGCCGTCGCCGTCTCCCTCCAAGGCAGTTCAAGACGGGAAAGGAGGGCAAG
ACGAGGCAAAGGACATGAAGCTTGCTGCTCGCAGAGTCTCCAAGGCCAAGTCTGAGGCGGCCAACGCGGCGCTGG
ACCCAGCGCATCCTCTGCACATTACCCTGCCCACCTTTCGCATGGTTGTCCTGGCCGATGAGCTGCTGGAGCAGT
TTTTCGAGTCTTCGTTTCCCGCCTCGTTTCGTGTCACTCAAGGCGTGCAGGGCGTGGCCGCCACGACTCCCACGT
CGTCTCTCACCACCTTTTCCAGCTTGGGCTTCGGGCCAAGATCTCCAGGCTTGTTGCAGAGCGGCCCGCCCGGGC
CACCGGGCCGGGGTCTGCGCGGCGTGCTGGACAACATTGTGACGGACGGGATGCGCGTGGCGACCGAGGTACGAC
GGCGCATGGAGGAAGCACAAAAGGAACTAGATAGGCATGCAGTGCCTGGCCAAAGACCAGATGACGACGATGACG
ATGACGACGATGACGCGGGCGCCATGCTAGGGCACAGCAGGACAAGCGTTGGGCGAGGCGCCGTCAGTCAGGACA
TTGAGCGGCGTTCAGTCAAGAGCACAGATCGCGATTTACTAGACGGGCTCGATGCCGAAGCTGGAGTCTCATCCA
AGGAGCACGACAAGAGCCTCTTGGACACTGACGACACGGAGCCCCACCGCCAGGCAGATGCTGCCGTAACAGACG
CGGGCTCGGCCATCTTGGAATTTGAGGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail