Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1952
Gene name
LocationContig_158:19472..20519
Strand-
Gene length (bp)1047
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.5E-18 6 198
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.9E-13 10 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21158|CSGA_MYXXA C-factor OS=Myxococcus xanthus GN=csgA PE=1 SV=1 99 195 4.0E-13
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 7 240 8.0E-12
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 7 236 1.0E-11
sp|Q9P7I6|YJNK_SCHPO Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 7 242 2.0E-11
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 7 236 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21158|CSGA_MYXXA C-factor OS=Myxococcus xanthus GN=csgA PE=1 SV=1 99 195 4.0E-13
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 7 240 8.0E-12
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 7 236 1.0E-11
sp|Q9P7I6|YJNK_SCHPO Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 7 242 2.0E-11
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 7 236 3.0E-11
sp|P36086|YKH1_YEAST Uncharacterized oxidoreductase YKL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL071W PE=1 SV=1 2 221 6.0E-10
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 7 228 1.0E-09
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 7 203 1.0E-09
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 1 234 3.0E-08
sp|P50161|AFLM_ASPPA Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 7 228 7.0E-08
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 7 203 1.0E-07
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 7 203 1.0E-07
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 1 196 3.0E-07
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 7 203 4.0E-07
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 7 203 4.0E-07
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 2 196 6.0E-07
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 97 228 1.0E-06
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 1 201 1.0E-06
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 7 196 3.0E-06
sp|P39333|BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 1 230 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1952
MTRWSVLIVGATRGLGASLVRQYAQRQDTVVYATTRSNIVPSSFDEHVKWLTGVDLMDAGAGDGIVKQLNMGEAE
ALSAVIISAGHFTSEDLGTGKGPNWSEEQRMYTTSAVAPVFITHRLVQAGLVRRQGGRIVLVSSEAGSIGLRHAN
EGGGNYAHHGSKAALNMAGRLLSLDLEAEGIVVSMVHPGFMRTDMTAGVGFDKFWDQGHAVTADQAASSLIAWTD
GLDMSKTGQLWAPRGPRDIGTAEAVMGANLPTPLQLPW*
Coding >OphauB2|1952
ATGACGAGGTGGTCGGTGCTCATTGTTGGGGCTACACGAGGCCTAGGAGCGAGCCTGGTGAGGCAGTATGCGCAG
CGCCAGGACACGGTGGTGTACGCAACAACCAGGTCCAACATTGTGCCGAGCAGCTTCGACGAGCATGTCAAGTGG
CTGACGGGCGTGGACCTGATGGATGCCGGGGCGGGGGATGGTATTGTAAAGCAGCTAAACATGGGGGAAGCAGAG
GCTCTCTCAGCCGTGATCATCTCGGCCGGACACTTCACCAGCGAGGACCTGGGCACGGGCAAAGGGCCCAACTGG
AGCGAGGAGCAGCGCATGTACACGACGAGTGCCGTGGCGCCCGTCTTCATCACCCACCGGCTGGTGCAGGCGGGC
TTGGTCAGGCGGCAGGGCGGGCGCATTGTGCTGGTGTCGTCCGAGGCGGGCAGCATCGGGCTGCGACACGCAAAC
GAGGGCGGCGGCAACTACGCGCATCACGGCAGCAAGGCGGCGCTCAACATGGCGGGGCGGCTGCTGAGTCTTGAT
CTCGAGGCCGAGGGCATCGTCGTGTCCATGGTGCATCCAGGCTTCATGCGCACCGACATGACGGCGGGCGTGGGC
TTTGACAAGTTCTGGGACCAGGGCCACGCCGTCACTGCCGACCAGGCGGCCTCGAGCCTGATTGCCTGGACAGAC
GGGCTCGACATGAGCAAGACGGGCCAGCTGTGGGCGCCGCGAGGACCGCGTGATATTGGCACGGCCGAGGCCGTC
ATGGGCGCCAATCTGCCGACGCCACTCCAGCTGCCGTGGTGA
Transcript >OphauB2|1952
ATGACGAGGTGGTCGGTGCTCATTGTTGGGGCTACACGAGGCCTAGGAGCGAGCCTGGTGAGGCAGTATGCGCAG
CGCCAGGACACGGTGGTGTACGCAACAACCAGGTCCAACATTGTGCCGAGCAGCTTCGACGAGCATGTCAAGTGG
CTGACGGGCGTGGACCTGATGGATGCCGGGGCGGGGGATGGTATTGTAAAGCAGCTAAACATGGGGGAAGCAGAG
GCTCTCTCAGCCGTGATCATCTCGGCCGGACACTTCACCAGCGAGGACCTGGGCACGGGCAAAGGGCCCAACTGG
AGCGAGGAGCAGCGCATGTACACGACGAGTGCCGTGGCGCCCGTCTTCATCACCCACCGGCTGGTGCAGGCGGGC
TTGGTCAGGCGGCAGGGCGGGCGCATTGTGCTGGTGTCGTCCGAGGCGGGCAGCATCGGGCTGCGACACGCAAAC
GAGGGCGGCGGCAACTACGCGCATCACGGCAGCAAGGCGGCGCTCAACATGGCGGGGCGGCTGCTGAGTCTTGAT
CTCGAGGCCGAGGGCATCGTCGTGTCCATGGTGCATCCAGGCTTCATGCGCACCGACATGACGGCGGGCGTGGGC
TTTGACAAGTTCTGGGACCAGGGCCACGCCGTCACTGCCGACCAGGCGGCCTCGAGCCTGATTGCCTGGACAGAC
GGGCTCGACATGAGCAAGACGGGCCAGCTGTGGGCGCCGCGAGGACCGCGTGATATTGGCACGGCCGAGGCCGTC
ATGGGCGCCAATCTGCCGACGCCACTCCAGCTGCCGTGGTGA
Gene >OphauB2|1952
ATGACGAGGTGGTCGGTGCTCATTGTTGGGGCTACACGAGGCCTAGGAGCGAGCCTGGTGAGGCAGTATGCGCAG
CGCCAGGACACGGTGGTGTACGCAACAACCAGGTCCAACATTGTGCCGAGCAGCTTCGACGAGCATGTCAAGTGG
CTGACGGGCGTGGACCTGATGGATGCCGGGGCGGGGGATGGTATTGTAAAGCAGCTAAACATGGGGGAAGCAGAG
GCTCTCTCAGCCGTGGTGCGCCGCCTGTCTACTCATGGTGTCTACTCATGGTGTCTAGTCTAGCTACTGACGCCG
TCTACCGAGGGCATGCGAGGCAGATCATCTCGGCCGGACACTTCACCAGCGAGGACCTGGGCACGGGCAAAGGGC
CCAACTGGAGCGAGGAGCAGCGCATGTACACGACGAGTGCCGTGGCGCCCGTCTTCATCACCCACCGGCTGGTGC
AGGCGGGCTTGGTCAGGCGGCAGGGCGGGCGCATTGTGCTGGTGTCGTCCGAGGCGGGCAGCATCGGGCTGCGAC
ACGCAAACGAGGGCGGCGGCAACTACGCGCATCACGGCAGCAAGGCGGCGCTCAACATGGCGGGGCGGCTGCTGA
GTCTTGATCTCGAGGCCGAGGGCATCGTCGTGTCCATGGTGCATCCAGGCTTCATGCGCACCGACATGACGGCGG
GCGTGGGCTTTGACAAGTTCTGGGACCAGGGCCACGGTGAGCCGCCTCTTGTGCCCTGGCGTAGCAGCTACCCAG
GCGCCTGTCCCACTGCTTGTCCCCCCCGCTGCTTGTCCCCCCGCTGCTAGCAGCCATGCTAACCGTGTACCTGGC
GCGAGGCTAGCCGTCACTGCCGACCAGGCGGCCTCGAGCCTGATTGCCTGGACAGACGGGCTCGACATGAGCAAG
ACGGGCCAGCTGTGGGCGCCGCGAGGACCGCGTAAGTTGGCCCTCGACGGCTCGAGGCCCTCCACTGACGGCAGC
GCAGGTGATATTGGCACGGCCGAGGCCGTCATGGGCGCCAATCTGCCGACGCCACTCCAGCTGCCGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail