Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1945
Gene name
LocationContig_158:3616..5122
Strand-
Gene length (bp)1506
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08743 Nse4_C Nse4 C-terminal 1.5E-30 372 461
PF15412 Nse4-Nse3_bdg Binding domain of Nse4/EID3 to Nse3-MAGE 8.3E-18 172 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6QPC8|EID3_BOVIN EP300-interacting inhibitor of differentiation 3 OS=Bos taurus GN=EID3 PE=2 SV=1 79 461 8.0E-22
sp|Q9NXX6|NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens GN=NSMCE4A PE=1 SV=2 121 461 9.0E-22
sp|Q6BDR8|NSE4_SCHPO Non-structural maintenance of chromosome element 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse4 PE=1 SV=1 120 478 8.0E-21
sp|A5LFW4|EID3_MACFA EP300-interacting inhibitor of differentiation 3 OS=Macaca fascicularis GN=EID3 PE=2 SV=1 118 463 9.0E-20
sp|Q8N140|EID3_HUMAN EP300-interacting inhibitor of differentiation 3 OS=Homo sapiens GN=EID3 PE=1 SV=1 118 463 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6QPC8|EID3_BOVIN EP300-interacting inhibitor of differentiation 3 OS=Bos taurus GN=EID3 PE=2 SV=1 79 461 8.0E-22
sp|Q9NXX6|NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens GN=NSMCE4A PE=1 SV=2 121 461 9.0E-22
sp|Q6BDR8|NSE4_SCHPO Non-structural maintenance of chromosome element 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse4 PE=1 SV=1 120 478 8.0E-21
sp|A5LFW4|EID3_MACFA EP300-interacting inhibitor of differentiation 3 OS=Macaca fascicularis GN=EID3 PE=2 SV=1 118 463 9.0E-20
sp|Q8N140|EID3_HUMAN EP300-interacting inhibitor of differentiation 3 OS=Homo sapiens GN=EID3 PE=1 SV=1 118 463 3.0E-19
sp|Q3V124|EID3_MOUSE EP300-interacting inhibitor of differentiation 3 OS=Mus musculus GN=Eid3 PE=1 SV=1 118 463 8.0E-19
sp|P43124|NSE4_YEAST Non-structural maintenance of chromosome element 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSE4 PE=1 SV=1 255 461 8.0E-16
sp|Q4V8G2|EID3_RAT EP300-interacting inhibitor of differentiation 3 OS=Rattus norvegicus GN=Eid3 PE=2 SV=2 373 463 3.0E-13
sp|Q2TBI1|NSE4A_BOVIN Non-structural maintenance of chromosomes element 4 homolog A OS=Bos taurus GN=NSMCE4A PE=2 SV=1 378 461 5.0E-12
sp|Q9C689|NSE4A_ARATH Non-structural maintenance of chromosomes element 4 homolog A OS=Arabidopsis thaliana GN=NSE4A PE=2 SV=1 117 465 2.0E-11
sp|F4JET1|NSE4B_ARATH Non-structural maintenance of chromosomes element 4 homolog B OS=Arabidopsis thaliana GN=NSE4B PE=2 SV=1 114 464 2.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1945
MPRRASQNGTGSDEDASRIATASQSLSPERVSSTTRVVSGSKRKRPSTTDDAWRRRQRTKDGDQDDQDQDDQDQD
DRDDDDDDDDDDDDQDDQDDQDDSHVQDVSEDEDIYDPDQPLEERRNVQKGYRDLLRDLTENGDEYLNKDSKGLR
ETILKADALSKKLRQTAEATIDSRLLVSTSDLSYRKALRLTRGSLSQGIDVDEFVSKCITYMRIGGGIADDCAPE
LSSTQRQRRRAVSRGMGGDDDDVGDDGDMMNWPHLGRFACMSHIRRPALAGFLLGPLSVEKKPRKITKRSAPFRP
DSLRETRPQELDVRELATKENDLTAICSKVMLRLNDVQQKAQETVADLIEDGMDDEEKIRIMHQHGLRSTGGIDL
MRFVVNPKSFAQTVENMFYVSFLIRDGRIEIEFDDFELPALAPVDPEADNEGLSRHGAAKHQAVLSIDMKTWRDI
TVTLGLTEPMIEHRKDVSGAGPGARGWYS*
Coding >OphauB2|1945
ATGCCTCGACGCGCCAGCCAAAATGGCACTGGCTCCGATGAAGACGCATCCCGGATTGCCACGGCCTCACAGTCA
TTATCCCCAGAACGAGTTTCTTCTACAACGCGCGTGGTTTCTGGGTCCAAAAGAAAGCGCCCGAGTACTACTGAC
GACGCGTGGCGCCGACGGCAGAGGACCAAAGACGGGGACCAAGATGATCAAGACCAAGATGATCAAGACCAAGAT
GACCGAGACGATGACGACGACGATGACGACGATGACGACGACCAAGACGACCAAGACGACCAAGACGACAGCCAC
GTGCAAGACGTCTCGGAAGATGAAGACATCTACGACCCCGATCAGCCGCTCGAGGAGCGCCGCAACGTGCAAAAG
GGCTATAGAGACTTGCTGCGGGACTTGACAGAAAATGGCGATGAGTACCTCAACAAGGACTCCAAAGGCCTGCGA
GAAACCATCCTCAAGGCTGACGCCCTCTCCAAGAAGCTGAGACAGACAGCTGAGGCGACAATTGACTCGCGCCTC
CTCGTCAGCACATCGGATCTCTCATATCGCAAGGCATTGCGCTTGACCCGCGGCAGTCTGTCTCAAGGCATCGAC
GTGGACGAGTTTGTCTCCAAGTGCATAACTTATATGCGAATTGGTGGTGGAATTGCCGATGACTGCGCCCCCGAG
CTCTCGAGTACCCAAAGACAGCGGCGACGAGCTGTCTCTCGAGGCATGGGCGGCGATGATGACGATGTCGGCGAT
GACGGAGACATGATGAATTGGCCCCATCTCGGCCGCTTTGCTTGTATGTCGCACATACGCCGGCCAGCTTTGGCG
GGATTCCTTCTCGGGCCGCTTTCTGTCGAGAAGAAGCCTCGAAAAATCACAAAGCGGAGTGCCCCATTTCGGCCC
GATAGCCTCAGGGAAACGCGTCCACAGGAGCTCGATGTAAGAGAGCTGGCGACCAAAGAAAACGACTTGACTGCC
ATCTGCTCCAAGGTCATGTTGCGCCTGAATGATGTGCAACAGAAAGCGCAGGAGACGGTTGCCGACTTGATCGAA
GACGGCATGGACGACGAGGAAAAGATACGCATTATGCACCAGCACGGCCTACGCAGCACGGGGGGCATCGATCTA
ATGCGCTTTGTCGTCAACCCCAAGTCATTTGCGCAGACAGTCGAGAACATGTTCTACGTCAGCTTCCTTATTCGT
GATGGCAGGATAGAGATTGAATTCGACGACTTTGAGCTGCCTGCACTAGCACCCGTTGATCCAGAAGCAGACAAC
GAGGGCCTTTCTCGGCATGGAGCTGCCAAGCACCAAGCTGTGTTATCTATAGACATGAAGACATGGCGCGACATC
ACTGTAACCCTTGGTCTTACAGAGCCCATGATTGAGCACAGAAAAGACGTGTCGGGTGCAGGTCCTGGGGCCCGC
GGGTGGTATAGCTGA
Transcript >OphauB2|1945
ATGCCTCGACGCGCCAGCCAAAATGGCACTGGCTCCGATGAAGACGCATCCCGGATTGCCACGGCCTCACAGTCA
TTATCCCCAGAACGAGTTTCTTCTACAACGCGCGTGGTTTCTGGGTCCAAAAGAAAGCGCCCGAGTACTACTGAC
GACGCGTGGCGCCGACGGCAGAGGACCAAAGACGGGGACCAAGATGATCAAGACCAAGATGATCAAGACCAAGAT
GACCGAGACGATGACGACGACGATGACGACGATGACGACGACCAAGACGACCAAGACGACCAAGACGACAGCCAC
GTGCAAGACGTCTCGGAAGATGAAGACATCTACGACCCCGATCAGCCGCTCGAGGAGCGCCGCAACGTGCAAAAG
GGCTATAGAGACTTGCTGCGGGACTTGACAGAAAATGGCGATGAGTACCTCAACAAGGACTCCAAAGGCCTGCGA
GAAACCATCCTCAAGGCTGACGCCCTCTCCAAGAAGCTGAGACAGACAGCTGAGGCGACAATTGACTCGCGCCTC
CTCGTCAGCACATCGGATCTCTCATATCGCAAGGCATTGCGCTTGACCCGCGGCAGTCTGTCTCAAGGCATCGAC
GTGGACGAGTTTGTCTCCAAGTGCATAACTTATATGCGAATTGGTGGTGGAATTGCCGATGACTGCGCCCCCGAG
CTCTCGAGTACCCAAAGACAGCGGCGACGAGCTGTCTCTCGAGGCATGGGCGGCGATGATGACGATGTCGGCGAT
GACGGAGACATGATGAATTGGCCCCATCTCGGCCGCTTTGCTTGTATGTCGCACATACGCCGGCCAGCTTTGGCG
GGATTCCTTCTCGGGCCGCTTTCTGTCGAGAAGAAGCCTCGAAAAATCACAAAGCGGAGTGCCCCATTTCGGCCC
GATAGCCTCAGGGAAACGCGTCCACAGGAGCTCGATGTAAGAGAGCTGGCGACCAAAGAAAACGACTTGACTGCC
ATCTGCTCCAAGGTCATGTTGCGCCTGAATGATGTGCAACAGAAAGCGCAGGAGACGGTTGCCGACTTGATCGAA
GACGGCATGGACGACGAGGAAAAGATACGCATTATGCACCAGCACGGCCTACGCAGCACGGGGGGCATCGATCTA
ATGCGCTTTGTCGTCAACCCCAAGTCATTTGCGCAGACAGTCGAGAACATGTTCTACGTCAGCTTCCTTATTCGT
GATGGCAGGATAGAGATTGAATTCGACGACTTTGAGCTGCCTGCACTAGCACCCGTTGATCCAGAAGCAGACAAC
GAGGGCCTTTCTCGGCATGGAGCTGCCAAGCACCAAGCTGTGTTATCTATAGACATGAAGACATGGCGCGACATC
ACTGTAACCCTTGGTCTTACAGAGCCCATGATTGAGCACAGAAAAGACGTGTCGGGTGCAGGTCCTGGGGCCCGC
GGGTGGTATAGCTGA
Gene >OphauB2|1945
ATGCCTCGACGCGCCAGCCAAAATGGCACTGGCTCCGATGAAGACGCATCCCGGATTGCCACGGCCTCACAGTCA
TTATCCCCAGAACGAGTTTCTTCTACAACGCGCGTGGTTTCTGGGTCCAAAAGAAAGCGCCCGAGTACTACTGAC
GACGCGTGGCGCCGACGGCAGAGGACCAAAGACGGGGACCAAGATGATCAAGACCAAGATGATCAAGACCAAGAT
GACCGAGACGATGACGACGACGATGACGACGATGACGACGACCAAGACGACCAAGACGACCAAGACGACAGCCAC
GTGCAAGACGTCTCGGAAGATGAAGACATCTACGACCCCGATCAGCCGCTCGAGGAGCGCCGCAACGTGCAAAAG
GGCTATAGAGACTTGCTGCGGGACTTGACAGAAAATGGCGATGAGTACCTCAACAAGGACTCCAAAGGCCTGCGA
GAAACCATCCTCAAGGCTGACGCCCTCTCCAAGAAGCTGAGACAGACAGCTGAGGCGACAATTGACTCGCGCCTC
CTCGTCAGCACATCGGATCTCTCATATCGCAAGGCATTGCGCTTGACCCGCGGCAGTCTGTCTCAAGGCATCGAC
GTGGACGAGTTTGTCTCCAAGTGCATAACTTATATGCGAATTGGTGGTGGAATTGCCGATGACTGCGCCCCCGAG
CTCTCGAGTACCCAAAGACAGCGGCGACGAGCTGTCTCTCGAGGCATGGGCGGCGATGATGACGATGTCGGCGAT
GACGGAGACATGATGAATTGGCCCCATCTCGGCCGCTTTGCTTGTATGTCGCACATACGCCGGCCAGCTTTGGCG
GGATTCCTTCTCGGGCCGCTTTCTGTCGAGAAGAAGCCTCGAAAAATCACAAAGCGGAGTGCCCCATTTCGGCCC
GATAGCCTCAGGGAAACGCGTCCACAGGAGCTCGATGTAAGAGAGCTGGCGACCAAAGAAAACGACTTGACTGCC
ATCTGCTCCAAGGTCATGTTGCGCCTGAATGATGTGCAACAGAAAGCGCAGGAGACGGTTGCCGACTTGATCGAA
GACGGCATGGACGACGAGGAAAAGATACGCATTATGCACCAGCACGGCCTACGCAGCACGGGGGGCATCGATCTA
ATGCGCTTTGTCGTCAACCCCAAGTCATTTGCGCAGACAGTCGAGAACATGTTCTACGTCAGCTTCCTTATTCGT
GATGGCAGGATAGAGATTGAATTCGACGACTTTGAGCTGCCTGCACTAGGTGAGTCCATTTTTCACAGCCGTGGT
TTGCTCATGTATTAGCCTGGCATTCTGACGCTCTCGACAGCACCCGTTGATCCAGAAGCAGACAACGAGGGCCTT
TCTCGGCATGGAGCTGCCAAGCACCAAGCTGTGTTATCTATAGACATGAAGACATGGCGCGACATCACTGTAACC
CTTGGTCTTACAGAGCCCATGATTGAGCACAGAAAAGACGTGTCGGGTGCAGGTCCTGGGGCCCGCGGGTGGTAT
AGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail