Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1935
Gene name
LocationContig_157:26663..27524
Strand-
Gene length (bp)861
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06148 COG2 COG (conserved oligomeric Golgi) complex component, COG2 3.4E-23 36 164

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1777
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7043
Ophiocordyceps australis map64 (Brazil) OphauB2|1935 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03112
Ophiocordyceps camponoti-rufipedis Ophun1|4749
Ophiocordyceps kimflemingae Ophio5|8101
Ophiocordyceps subramaniannii Hirsu2|1701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1935
MTVAARPRTLMALNPPPHDLALDPDAPLPFPTALPRSDFTVPSFDAAAYLSALPHRHQTLADLRADLRDRSAAIS
AELVQLVNDNYTAFLSLGADLAGGDQRVQSVRVALLGFRRAVAEVKARVAAKRLEAQTLCSELATVRADVEKGRT
LLELHERLEALEQCLHVDGPSDAMSDWSSEPSDEQDDAESAVHGLLASSPPKLLDAAHQCNRICAMASTLDDSHP
FVVKMQHRLTKCRTTLLLDLGNALKEARGAGPRAQHRVLDYLDIYRILDAQREAIKALGAG*
Coding >OphauB2|1935
ATGACCGTTGCCGCCCGCCCACGAACCCTCATGGCCCTCAATCCACCCCCCCACGACCTCGCCCTCGACCCCGAC
GCACCTCTTCCCTTTCCCACGGCCCTTCCACGCTCCGACTTCACGGTGCCCTCATTTGACGCTGCTGCCTACCTC
TCCGCCCTGCCCCACCGCCACCAAACCCTTGCCGACCTGCGCGCCGACCTGCGCGACCGCAGCGCTGCCATTAGC
GCCGAACTCGTCCAGCTCGTCAATGACAATTACACTGCCTTTCTCAGCCTGGGCGCTGACCTTGCCGGCGGCGAC
CAGCGTGTCCAAAGCGTCCGCGTCGCCCTCTTGGGCTTTCGCCGTGCTGTTGCCGAGGTCAAGGCCCGCGTTGCT
GCAAAACGCCTCGAGGCACAGACGCTCTGCTCCGAGCTGGCCACGGTCCGCGCAGATGTGGAAAAGGGCCGCACA
TTGCTCGAGTTGCATGAGCGCCTCGAGGCCTTGGAGCAGTGTCTCCATGTTGATGGGCCGTCAGACGCCATGTCT
GACTGGAGCTCGGAGCCCAGTGACGAGCAAGACGATGCCGAGTCGGCGGTGCATGGCTTGCTTGCAAGCTCGCCG
CCCAAACTACTAGACGCTGCCCACCAGTGCAATCGCATCTGCGCCATGGCATCTACGCTAGACGACTCGCATCCC
TTTGTCGTCAAGATGCAGCACCGCCTCACAAAGTGTCGCACCACACTGCTCCTCGATCTCGGCAACGCCCTCAAG
GAAGCTCGTGGAGCTGGTCCTCGCGCACAACATCGCGTCCTCGACTATCTCGACATTTATCGCATCCTTGATGCC
CAGCGAGAAGCTATAAAAGCTCTAGGTGCCGGTTGA
Transcript >OphauB2|1935
ATGACCGTTGCCGCCCGCCCACGAACCCTCATGGCCCTCAATCCACCCCCCCACGACCTCGCCCTCGACCCCGAC
GCACCTCTTCCCTTTCCCACGGCCCTTCCACGCTCCGACTTCACGGTGCCCTCATTTGACGCTGCTGCCTACCTC
TCCGCCCTGCCCCACCGCCACCAAACCCTTGCCGACCTGCGCGCCGACCTGCGCGACCGCAGCGCTGCCATTAGC
GCCGAACTCGTCCAGCTCGTCAATGACAATTACACTGCCTTTCTCAGCCTGGGCGCTGACCTTGCCGGCGGCGAC
CAGCGTGTCCAAAGCGTCCGCGTCGCCCTCTTGGGCTTTCGCCGTGCTGTTGCCGAGGTCAAGGCCCGCGTTGCT
GCAAAACGCCTCGAGGCACAGACGCTCTGCTCCGAGCTGGCCACGGTCCGCGCAGATGTGGAAAAGGGCCGCACA
TTGCTCGAGTTGCATGAGCGCCTCGAGGCCTTGGAGCAGTGTCTCCATGTTGATGGGCCGTCAGACGCCATGTCT
GACTGGAGCTCGGAGCCCAGTGACGAGCAAGACGATGCCGAGTCGGCGGTGCATGGCTTGCTTGCAAGCTCGCCG
CCCAAACTACTAGACGCTGCCCACCAGTGCAATCGCATCTGCGCCATGGCATCTACGCTAGACGACTCGCATCCC
TTTGTCGTCAAGATGCAGCACCGCCTCACAAAGTGTCGCACCACACTGCTCCTCGATCTCGGCAACGCCCTCAAG
GAAGCTCGTGGAGCTGGTCCTCGCGCACAACATCGCGTCCTCGACTATCTCGACATTTATCGCATCCTTGATGCC
CAGCGAGAAGCTATAAAAGCTCTAGGTGCCGGTTGA
Gene >OphauB2|1935
ATGACCGTTGCCGCCCGCCCACGAACCCTCATGGCCCTCAATCCACCCCCCCACGACCTCGCCCTCGACCCCGAC
GCACCTCTTCCCTTTCCCACGGCCCTTCCACGCTCCGACTTCACGGTGCCCTCATTTGACGCTGCTGCCTACCTC
TCCGCCCTGCCCCACCGCCACCAAACCCTTGCCGACCTGCGCGCCGACCTGCGCGACCGCAGCGCTGCCATTAGC
GCCGAACTCGTCCAGCTCGTCAATGACAATTACACTGCCTTTCTCAGCCTGGGCGCTGACCTTGCCGGCGGCGAC
CAGCGTGTCCAAAGCGTCCGCGTCGCCCTCTTGGGCTTTCGCCGTGCTGTTGCCGAGGTCAAGGCCCGCGTTGCT
GCAAAACGCCTCGAGGCACAGACGCTCTGCTCCGAGCTGGCCACGGTCCGCGCAGATGTGGAAAAGGGCCGCACA
TTGCTCGAGTTGCATGAGCGCCTCGAGGCCTTGGAGCAGTGTCTCCATGTTGATGGGCCGTCAGACGCCATGTCT
GACTGGAGCTCGGAGCCCAGTGACGAGCAAGACGATGCCGAGTCGGCGGTGCATGGCTTGCTTGCAAGCTCGCCG
CCCAAACTACTAGACGCTGCCCACCAGTGCAATCGCATCTGCGCCATGGCATCTACGCTAGACGACTCGCATCCC
TTTGTCGTCAAGATGCAGCACCGCCTCACAAAGTGTCGCACCACACTGCTCCTCGATCTCGGCAACGCCCTCAAG
GAAGCTCGTGGAGCTGGTCCTCGCGCACAACATCGCGTCCTCGACTATCTCGACATTTATCGCATCCTTGATGCC
CAGCGAGAAGCTATAAAAGCTCTAGGTGCCGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail