Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1929
Gene name
LocationContig_157:13435..15538
Strand+
Gene length (bp)2103
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 1.8E-47 173 344
PF00271 Helicase_C Helicase conserved C-terminal domain 2.5E-24 386 491
PF13959 DUF4217 Domain of unknown function (DUF4217) 1.9E-20 533 593

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 97 618 0.0E+00
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 78 618 0.0E+00
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 95 618 0.0E+00
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 109 624 0.0E+00
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 102 624 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 97 618 0.0E+00
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 78 618 0.0E+00
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 95 618 0.0E+00
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 109 624 0.0E+00
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 102 624 0.0E+00
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 4 625 0.0E+00
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 4 625 0.0E+00
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 84 624 0.0E+00
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 123 624 0.0E+00
sp|A2Q9T6|HAS1_ASPNC ATP-dependent RNA helicase has1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=has1 PE=3 SV=1 113 624 0.0E+00
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 102 624 0.0E+00
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 80 618 0.0E+00
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 59 611 0.0E+00
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 110 610 0.0E+00
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 151 610 0.0E+00
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 105 624 0.0E+00
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 151 600 0.0E+00
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 139 600 0.0E+00
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 150 600 0.0E+00
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 144 625 0.0E+00
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 144 600 0.0E+00
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 150 600 0.0E+00
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 151 605 0.0E+00
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 145 609 0.0E+00
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 151 626 0.0E+00
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 151 626 0.0E+00
sp|Q4P6N0|HAS1_USTMA ATP-dependent RNA helicase HAS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAS1 PE=3 SV=2 151 601 0.0E+00
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 151 615 0.0E+00
sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2 88 600 0.0E+00
sp|Q8K363|DDX18_MOUSE ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=1 SV=1 110 599 0.0E+00
sp|Q9VD51|DDX18_DROME Probable ATP-dependent RNA helicase pitchoune OS=Drosophila melanogaster GN=pit PE=2 SV=2 146 600 0.0E+00
sp|Q84T03|RH27_ORYSJ DEAD-box ATP-dependent RNA helicase 27 OS=Oryza sativa subsp. japonica GN=Os03g0802700 PE=3 SV=1 151 626 0.0E+00
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 150 612 0.0E+00
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 150 597 0.0E+00
sp|Q0DBS1|RH51_ORYSJ Putative DEAD-box ATP-dependent RNA helicase 51 OS=Oryza sativa subsp. japonica GN=Os06g0535100 PE=3 SV=2 151 624 0.0E+00
sp|Q5ZJF6|DDX10_CHICK Probable ATP-dependent RNA helicase DDX10 OS=Gallus gallus GN=DDX10 PE=2 SV=1 144 593 4.0E-117
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 144 593 9.0E-117
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 144 593 1.0E-116
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 144 593 7.0E-114
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 148 605 9.0E-109
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 141 610 1.0E-107
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 150 611 4.0E-107
sp|Q54Q94|DDX10_DICDI Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1 143 605 2.0E-106
sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 151 605 1.0E-105
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 147 605 9.0E-105
sp|Q5BFU1|DBP4_EMENI ATP-dependent RNA helicase dbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp4 PE=3 SV=1 150 609 1.0E-104
sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 151 605 2.0E-104
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 150 609 2.0E-104
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 141 611 2.0E-104
sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 150 611 3.0E-104
sp|A1DNF9|DBP4_NEOFI ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1 150 611 7.0E-104
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 141 614 7.0E-104
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 151 614 9.0E-104
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 150 598 4.0E-103
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 146 605 2.0E-101
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 146 614 6.0E-100
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 148 619 2.0E-98
sp|Q9FFT9|RH32_ARATH DEAD-box ATP-dependent RNA helicase 32 OS=Arabidopsis thaliana GN=RH32 PE=2 SV=1 151 596 6.0E-98
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 149 610 4.0E-96
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 124 605 3.0E-95
sp|Q6FPT7|DBP4_CANGA ATP-dependent RNA helicase DBP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP4 PE=3 SV=1 148 595 7.0E-95
sp|Q6ZPL9|DDX55_MOUSE ATP-dependent RNA helicase DDX55 OS=Mus musculus GN=Ddx55 PE=1 SV=2 153 593 6.0E-93
sp|P20448|DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCA4 PE=1 SV=2 143 624 8.0E-93
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 146 610 9.0E-93
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 143 610 1.0E-92
sp|A6ZPU3|DBP4_YEAS7 ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1 143 624 2.0E-92
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 141 595 4.0E-92
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 141 595 4.0E-92
sp|Q5ZLN8|DDX55_CHICK ATP-dependent RNA helicase DDX55 OS=Gallus gallus GN=DDX55 PE=2 SV=1 156 593 5.0E-91
sp|Q8GXD6|RH49_ARATH DEAD-box ATP-dependent RNA helicase 49 OS=Arabidopsis thaliana GN=RH49 PE=2 SV=2 151 593 1.0E-90
sp|A5DLF4|DBP4_PICGU ATP-dependent RNA helicase DBP4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP4 PE=3 SV=2 149 615 1.0E-90
sp|A7TJ71|DBP4_VANPO ATP-dependent RNA helicase DBP4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP4 PE=3 SV=1 151 619 3.0E-90
sp|Q8JHJ2|DDX55_DANRE ATP-dependent RNA helicase DDX55 OS=Danio rerio GN=ddx55 PE=2 SV=2 154 593 4.0E-89
sp|A3GGE9|DBP4_PICST ATP-dependent RNA helicase DBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP4 PE=3 SV=2 149 610 5.0E-89
sp|Q6AZV7|DDX55_XENLA ATP-dependent RNA helicase DDX55 OS=Xenopus laevis GN=ddx55 PE=2 SV=1 155 593 1.0E-88
sp|Q8NHQ9|DDX55_HUMAN ATP-dependent RNA helicase DDX55 OS=Homo sapiens GN=DDX55 PE=1 SV=3 156 593 2.0E-87
sp|Q2NL08|DDX55_BOVIN ATP-dependent RNA helicase DDX55 OS=Bos taurus GN=DDX55 PE=2 SV=1 156 593 2.0E-87
sp|Q0D622|RH32_ORYSJ DEAD-box ATP-dependent RNA helicase 32 OS=Oryza sativa subsp. japonica GN=Os07g0517000 PE=2 SV=2 143 593 2.0E-87
sp|Q6NZQ2|DDX31_MOUSE Probable ATP-dependent RNA helicase DDX31 OS=Mus musculus GN=Ddx31 PE=2 SV=2 151 592 1.0E-86
sp|Q0DLB9|RH17_ORYSJ DEAD-box ATP-dependent RNA helicase 17 OS=Oryza sativa subsp. japonica GN=Os05g0110500 PE=2 SV=2 148 591 3.0E-86
sp|Q761Z9|RH18_ORYSJ DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sativa subsp. japonica GN=Os01g0164500 PE=1 SV=2 151 591 3.0E-86
sp|Q9VHU1|DDX55_DROME Probable ATP-dependent RNA helicase DDX55 homolog OS=Drosophila melanogaster GN=CG9630 PE=2 SV=1 156 593 2.0E-85
sp|Q9FLB0|RH18_ARATH DEAD-box ATP-dependent RNA helicase 18 OS=Arabidopsis thaliana GN=RH18 PE=2 SV=1 149 591 2.0E-84
sp|Q7XJN0|RH17_ARATH DEAD-box ATP-dependent RNA helicase 17 OS=Arabidopsis thaliana GN=RH17 PE=2 SV=1 148 610 6.0E-84
sp|Q9H8H2|DDX31_HUMAN Probable ATP-dependent RNA helicase DDX31 OS=Homo sapiens GN=DDX31 PE=1 SV=2 148 616 4.0E-82
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 139 520 2.0E-75
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 149 502 6.0E-75
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 147 520 7.0E-75
sp|Q86B47|Y8611_DROME Probable ATP-dependent RNA helicase CG8611 OS=Drosophila melanogaster GN=CG8611 PE=1 SV=1 41 591 8.0E-75
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 147 519 1.0E-74
sp|A2QE29|SPB4_ASPNC ATP-dependent rRNA helicase spb4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=spb4 PE=3 SV=2 138 601 2.0E-74
sp|A6RMZ2|SPB4_BOTFB ATP-dependent rRNA helicase spb4 OS=Botryotinia fuckeliana (strain B05.10) GN=spb4 PE=3 SV=1 143 593 4.0E-74
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 101 501 8.0E-73
sp|O60173|DBP7_SCHPO ATP-dependent RNA helicase dbp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp7 PE=3 SV=1 149 608 2.0E-72
sp|Q0DBU5|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31 OS=Oryza sativa subsp. japonica GN=Os06g0526600 PE=3 SV=2 151 611 2.0E-72
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 86 502 3.0E-72
sp|A1D699|SPB4_NEOFI ATP-dependent rRNA helicase spb4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=spb4 PE=3 SV=1 142 601 3.0E-72
sp|Q6C835|DBP7_YARLI ATP-dependent RNA helicase DBP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP7 PE=3 SV=1 147 605 4.0E-72
sp|Q4WYJ7|SPB4_ASPFU ATP-dependent rRNA helicase spb4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spb4 PE=3 SV=2 142 601 4.0E-72
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 121 502 1.0E-71
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 149 502 2.0E-71
sp|Q5B8F4|SPB4_EMENI ATP-dependent rRNA helicase spb4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb4 PE=3 SV=1 142 601 2.0E-71
sp|A7F2S3|SPB4_SCLS1 ATP-dependent rRNA helicase spb4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=spb4 PE=3 SV=1 143 601 2.0E-71
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 108 502 2.0E-71
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 151 624 3.0E-71
sp|Q54EC2|DDX55_DICDI Probable ATP-dependent RNA helicase ddx55 OS=Dictyostelium discoideum GN=ddx55 PE=3 SV=1 153 593 3.0E-71
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 150 502 4.0E-71
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 76 515 5.0E-71
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 150 498 6.0E-71
sp|Q59S50|DBP7_CANAL ATP-dependent RNA helicase DBP7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP7 PE=3 SV=1 141 602 8.0E-71
sp|Q0JL73|RH26_ORYSJ DEAD-box ATP-dependent RNA helicase 26 OS=Oryza sativa subsp. japonica GN=Os01g0618500 PE=2 SV=1 151 611 8.0E-71
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 148 502 2.0E-70
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 150 502 2.0E-70
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 102 531 2.0E-70
sp|Q5ZBH5|RH25_ORYSJ DEAD-box ATP-dependent RNA helicase 25 OS=Oryza sativa subsp. japonica GN=Os01g0618400 PE=2 SV=1 151 611 3.0E-70
sp|Q2UBZ5|SPB4_ASPOR ATP-dependent rRNA helicase spb4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spb4 PE=3 SV=1 142 601 4.0E-70
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 150 500 6.0E-70
sp|Q1E1R7|SPB4_COCIM ATP-dependent rRNA helicase SPB4 OS=Coccidioides immitis (strain RS) GN=SPB4 PE=3 SV=2 142 605 1.0E-69
sp|Q8SR49|SPB4_ENCCU ATP-dependent rRNA helicase SPB4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPB4 PE=3 SV=1 162 591 2.0E-69
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 149 502 2.0E-69
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 143 493 3.0E-69
sp|A5DAR2|DBP7_PICGU ATP-dependent RNA helicase DBP7 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP7 PE=3 SV=3 52 625 4.0E-69
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 145 516 4.0E-69
sp|Q0CQF3|SPB4_ASPTN ATP-dependent rRNA helicase spb4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=spb4 PE=3 SV=1 142 601 5.0E-69
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 149 611 6.0E-69
sp|A1CL59|SPB4_ASPCL ATP-dependent rRNA helicase spb4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=spb4 PE=3 SV=1 142 601 7.0E-69
sp|A1CB55|DBP7_ASPCL ATP-dependent RNA helicase dbp7 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp7 PE=3 SV=1 139 620 1.0E-68
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 151 610 2.0E-68
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 150 549 4.0E-68
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 150 502 4.0E-68
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 150 502 4.0E-68
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 101 531 5.0E-68
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 94 549 5.0E-68
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 88 502 5.0E-68
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 75 549 2.0E-67
sp|Q4HZ68|DBP7_GIBZE ATP-dependent RNA helicase DBP7 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP7 PE=3 SV=1 146 591 2.0E-67
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 150 506 2.0E-67
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 150 494 2.0E-67
sp|Q6BKH3|DBP7_DEBHA ATP-dependent RNA helicase DBP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP7 PE=3 SV=1 141 610 4.0E-67
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 144 502 4.0E-67
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 149 502 4.0E-67
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 150 531 5.0E-67
sp|A1DE84|DBP7_NEOFI ATP-dependent RNA helicase dbp7 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp7 PE=3 SV=1 111 607 7.0E-67
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 150 516 8.0E-67
sp|A6RSH5|DBP7_BOTFB ATP-dependent RNA helicase dbp7 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp7 PE=3 SV=1 139 591 9.0E-67
sp|A3LWH3|DBP7_PICST ATP-dependent RNA helicase DBP7 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DPB7 PE=3 SV=2 136 592 1.0E-66
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 150 499 1.0E-66
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 138 507 1.0E-66
sp|Q0UP45|SPB4_PHANO ATP-dependent rRNA helicase SPB4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SPB4 PE=3 SV=1 156 591 2.0E-66
sp|Q4WV71|DBP7_ASPFU ATP-dependent RNA helicase dbp7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp7 PE=3 SV=1 139 607 2.0E-66
sp|Q1E9T9|DBP7_COCIM ATP-dependent RNA helicase DBP7 OS=Coccidioides immitis (strain RS) GN=DBP7 PE=3 SV=1 139 591 2.0E-66
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 108 502 3.0E-66
sp|A7F8V8|DBP7_SCLS1 ATP-dependent RNA helicase dbp7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp7 PE=3 SV=1 139 591 5.0E-66
sp|Q873H9|SPB4_NEUCR ATP-dependent rRNA helicase spb-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spb-4 PE=3 SV=1 142 593 8.0E-66
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 143 515 1.0E-65
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 143 515 1.0E-65
sp|A5DGM4|SPB4_PICGU ATP-dependent rRNA helicase SPB4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SPB4 PE=3 SV=2 146 593 1.0E-65
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 150 502 1.0E-65
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 150 502 2.0E-65
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 104 502 4.0E-65
sp|Q0UHM7|DBP7_PHANO ATP-dependent RNA helicase DBP7 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP7 PE=3 SV=1 139 591 5.0E-65
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 150 516 5.0E-65
sp|A6R918|SPB4_AJECN ATP-dependent rRNA helicase SPB4 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SPB4 PE=3 SV=2 139 587 6.0E-65
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 134 502 1.0E-64
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 134 502 1.0E-64
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 149 502 1.0E-64
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 71 502 3.0E-64
sp|Q5BGX6|DBP7_EMENI ATP-dependent RNA helicase dbp7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp7 PE=3 SV=1 34 625 4.0E-64
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 71 502 5.0E-64
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 150 531 6.0E-64
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 150 502 6.0E-64
sp|Q0CF43|DBP7_ASPTN ATP-dependent RNA helicase dbp7 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp7 PE=3 SV=2 118 603 7.0E-64
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 150 502 1.0E-63
sp|Q8SR01|DBP4_ENCCU ATP-dependent RNA helicase DBP4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP4 PE=3 SV=2 151 506 1.0E-63
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 150 510 1.0E-63
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 150 541 2.0E-63
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 149 502 2.0E-63
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 88 501 2.0E-63
sp|P34640|DDX55_CAEEL Probable ATP-dependent RNA helicase DDX55 homolog OS=Caenorhabditis elegans GN=ZK512.2 PE=3 SV=2 150 593 3.0E-63
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 142 499 7.0E-63
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 139 538 7.0E-63
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 149 499 1.0E-62
sp|Q61R02|DDX55_CAEBR Probable ATP-dependent RNA helicase DDX55 homolog OS=Caenorhabditis briggsae GN=CBG06798 PE=3 SV=1 155 593 1.0E-62
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 47 541 1.0E-62
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 82 494 2.0E-62
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 150 502 2.0E-62
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 108 502 2.0E-62
sp|Q2GV49|SPB4_CHAGB ATP-dependent rRNA helicase SPB4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SPB4 PE=3 SV=1 156 609 2.0E-62
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 118 513 4.0E-62
sp|Q6K7R9|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48 OS=Oryza sativa subsp. japonica GN=Os02g0826100 PE=2 SV=1 151 610 5.0E-62
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 150 538 5.0E-62
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 149 518 6.0E-62
sp|A2RA55|DBP7_ASPNC ATP-dependent RNA helicase dbp7 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp7 PE=3 SV=1 136 591 7.0E-62
sp|Q2UE66|DBP7_ASPOR ATP-dependent RNA helicase dbp7 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp7 PE=3 SV=1 136 626 9.0E-62
sp|Q4HVW2|SPB4_GIBZE ATP-dependent rRNA helicase SPB4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPB4 PE=3 SV=1 156 593 2.0E-61
sp|P25808|SPB4_YEAST ATP-dependent rRNA helicase SPB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPB4 PE=1 SV=1 163 593 2.0E-61
sp|A7A237|SPB4_YEAS7 ATP-dependent rRNA helicase SPB4 OS=Saccharomyces cerevisiae (strain YJM789) GN=SPB4 PE=3 SV=1 163 593 2.0E-61
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 150 507 2.0E-61
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 150 498 2.0E-61
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 150 498 2.0E-61
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 119 499 3.0E-61
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 151 513 4.0E-61
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 151 537 4.0E-61
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 149 518 4.0E-61
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 150 498 1.0E-60
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 150 498 2.0E-60
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 149 502 2.0E-60
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 149 502 2.0E-60
sp|Q2UST1|MS116_ASPOR ATP-dependent RNA helicase mss116, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mss116 PE=3 SV=1 155 608 3.0E-60
sp|A7TNT1|DBP7_VANPO ATP-dependent RNA helicase DBP7 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP7 PE=3 SV=1 118 593 4.0E-60
sp|Q6FKS8|SPB4_CANGA ATP-dependent rRNA helicase SPB4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPB4 PE=3 SV=1 162 593 5.0E-60
sp|Q59NP8|SPB42_CANAL ATP-dependent rRNA helicase SPB42 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPB42 PE=3 SV=1 163 593 6.0E-60
sp|Q59N29|SPB4_CANAL ATP-dependent rRNA helicase SPB41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPB4 PE=3 SV=1 163 593 6.0E-60
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 149 529 7.0E-60
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 150 538 8.0E-60
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 150 502 1.0E-59
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 150 502 1.0E-59
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 150 501 1.0E-59
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 142 502 1.0E-59
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 150 502 2.0E-59
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 150 521 4.0E-59
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 151 510 4.0E-59
sp|A7TJS7|SPB4_VANPO ATP-dependent rRNA helicase SPB4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SPB4 PE=3 SV=1 163 593 4.0E-59
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 150 502 5.0E-59
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 150 502 5.0E-59
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 116 498 5.0E-59
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 142 502 6.0E-59
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 151 513 6.0E-59
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 150 513 6.0E-59
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 149 510 7.0E-59
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 151 513 8.0E-59
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 148 502 8.0E-59
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 151 513 8.0E-59
sp|Q6C193|SPB4_YARLI ATP-dependent rRNA helicase SPB4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPB4 PE=3 SV=1 148 593 9.0E-59
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 148 502 9.0E-59
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 151 513 9.0E-59
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 41 502 1.0E-58
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 151 545 2.0E-58
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 110 519 2.0E-58
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 150 502 2.0E-58
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 150 502 3.0E-58
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 140 510 3.0E-58
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 151 513 3.0E-58
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 150 513 4.0E-58
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 151 527 4.0E-58
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 149 502 5.0E-58
sp|Q9FVV4|RH55_ARATH DEAD-box ATP-dependent RNA helicase 55 OS=Arabidopsis thaliana GN=RH55 PE=3 SV=1 151 469 5.0E-58
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 150 502 5.0E-58
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 151 527 7.0E-58
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 150 502 7.0E-58
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 149 529 9.0E-58
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 149 529 9.0E-58
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 151 516 1.0E-57
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 150 501 1.0E-57
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 151 505 1.0E-57
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 149 502 1.0E-57
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 151 502 1.0E-57
sp|P15424|MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS116 PE=1 SV=1 156 521 1.0E-57
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 149 510 2.0E-57
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 148 502 2.0E-57
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 149 505 3.0E-57
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 149 510 4.0E-57
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 151 516 4.0E-57
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 151 516 4.0E-57
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 151 516 4.0E-57
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 151 516 4.0E-57
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 151 516 4.0E-57
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 151 516 4.0E-57
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 151 516 4.0E-57
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 151 516 4.0E-57
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 151 516 5.0E-57
sp|Q15N18|RHLB_PSEA6 ATP-dependent RNA helicase RhlB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rhlB PE=3 SV=1 149 527 6.0E-57
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 144 490 8.0E-57
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 149 501 9.0E-57
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 169 522 9.0E-57
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 141 502 1.0E-56
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 146 502 1.0E-56
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 151 530 2.0E-56
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 110 501 2.0E-56
sp|A3LQW7|DBP2_PICST ATP-dependent RNA helicase DBP2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP2 PE=3 SV=1 149 485 2.0E-56
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 147 502 3.0E-56
sp|Q07886|DDX49_DROME Probable ATP-dependent RNA helicase Dbp45A OS=Drosophila melanogaster GN=Dbp45A PE=2 SV=2 147 513 3.0E-56
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 141 490 3.0E-56
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 147 515 3.0E-56
sp|Q7S873|DBP7_NEUCR ATP-dependent RNA helicase dbp-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-7 PE=3 SV=1 139 513 4.0E-56
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 150 510 5.0E-56
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 147 502 6.0E-56
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 114 510 6.0E-56
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 129 513 6.0E-56
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 149 502 6.0E-56
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 150 502 7.0E-56
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 149 502 7.0E-56
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 151 532 7.0E-56
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 151 515 8.0E-56
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 150 499 9.0E-56
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 151 527 9.0E-56
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 149 513 1.0E-55
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 149 510 1.0E-55
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 150 502 1.0E-55
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 150 516 2.0E-55
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 151 502 2.0E-55
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 151 532 2.0E-55
sp|Q2GZU7|DBP7_CHAGB ATP-dependent RNA helicase DBP7 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP7 PE=3 SV=1 143 516 2.0E-55
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 150 502 2.0E-55
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 150 502 3.0E-55
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 149 513 3.0E-55
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 149 513 3.0E-55
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 149 513 3.0E-55
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 149 513 3.0E-55
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 52 539 4.0E-55
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 149 513 4.0E-55
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 116 490 4.0E-55
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 150 513 4.0E-55
sp|Q0UG00|MS116_PHANO ATP-dependent RNA helicase MSS116, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSS116 PE=3 SV=1 144 608 4.0E-55
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 151 518 5.0E-55
sp|Q6CN92|SPB4_KLULA ATP-dependent rRNA helicase SPB4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPB4 PE=3 SV=1 163 593 6.0E-55
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 149 513 7.0E-55
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 144 490 8.0E-55
sp|Q1K8F7|CYT19_NEUCR ATP-dependent RNA helicase cyt-19, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-19 PE=1 SV=1 151 610 9.0E-55
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 150 551 9.0E-55
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 151 513 9.0E-55
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 151 527 1.0E-54
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 151 527 1.0E-54
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 150 501 1.0E-54
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 149 491 1.0E-54
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 111 505 1.0E-54
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 109 501 2.0E-54
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 151 502 2.0E-54
sp|A5DS77|DBP2_LODEL ATP-dependent RNA helicase DBP2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP2 PE=3 SV=1 149 485 2.0E-54
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 150 513 2.0E-54
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 101 502 2.0E-54
sp|Q8EJQ5|RHLB_SHEON ATP-dependent RNA helicase RhlB OS=Shewanella oneidensis (strain MR-1) GN=rhlB PE=3 SV=1 151 527 3.0E-54
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 107 490 3.0E-54
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 154 491 3.0E-54
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 150 502 3.0E-54
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 141 493 4.0E-54
sp|P0C2N7|DRS1_CHAGB ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRS1 PE=3 SV=1 149 498 4.0E-54
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 141 493 4.0E-54
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 142 504 6.0E-54
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 164 506 6.0E-54
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 151 527 7.0E-54
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 151 527 7.0E-54
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 150 502 7.0E-54
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 151 527 7.0E-54
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 151 527 7.0E-54
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 151 502 8.0E-54
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 151 519 8.0E-54
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 169 526 8.0E-54
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 139 506 1.0E-53
sp|O74764|SPB4_SCHPO ATP-dependent rRNA helicase spb4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spb4 PE=3 SV=1 150 593 1.0E-53
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 139 506 1.0E-53
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 150 513 1.0E-53
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 151 527 1.0E-53
sp|B8CHZ1|RHLB_SHEPW ATP-dependent RNA helicase RhlB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rhlB PE=3 SV=1 151 527 1.0E-53
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 149 503 2.0E-53
sp|A5E2I8|SPB4_LODEL ATP-dependent rRNA helicase SPB4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SPB4 PE=3 SV=1 163 593 2.0E-53
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 150 526 2.0E-53
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 109 513 2.0E-53
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 123 490 2.0E-53
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 150 507 2.0E-53
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 135 513 2.0E-53
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 131 502 2.0E-53
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 151 527 3.0E-53
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 151 527 3.0E-53
sp|Q6FM43|PRP28_CANGA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP28 PE=3 SV=1 161 502 3.0E-53
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 150 513 3.0E-53
sp|O80792|RH33_ARATH Putative DEAD-box ATP-dependent RNA helicase 33 OS=Arabidopsis thaliana GN=RH33 PE=3 SV=1 144 608 3.0E-53
sp|Q7RZH4|MAK5_NEUCR ATP-dependent RNA helicase mak-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mak-5 PE=3 SV=1 147 506 3.0E-53
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 149 510 3.0E-53
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 151 510 3.0E-53
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 150 516 3.0E-53
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 136 502 4.0E-53
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 151 513 4.0E-53
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 151 504 4.0E-53
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 151 501 5.0E-53
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 136 571 5.0E-53
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 141 502 6.0E-53
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 151 501 6.0E-53
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 168 526 6.0E-53
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 110 490 6.0E-53
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 139 502 6.0E-53
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 150 513 8.0E-53
sp|Q9C8S9|RH48_ARATH Probable DEAD-box ATP-dependent RNA helicase 48 OS=Arabidopsis thaliana GN=RH48 PE=3 SV=1 144 608 9.0E-53
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 136 571 9.0E-53
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 141 493 9.0E-53
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 150 498 9.0E-53
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 139 502 1.0E-52
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 148 520 1.0E-52
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 114 582 1.0E-52
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 151 509 1.0E-52
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 169 522 1.0E-52
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 122 490 1.0E-52
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 122 490 1.0E-52
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 135 490 1.0E-52
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 78 510 1.0E-52
sp|O13622|MS116_SCHPO ATP-dependent RNA helicase mss116, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mss116 PE=3 SV=1 149 568 1.0E-52
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 150 516 1.0E-52
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 150 502 2.0E-52
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 149 501 2.0E-52
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 151 522 2.0E-52
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 151 522 2.0E-52
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 169 522 2.0E-52
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 151 501 2.0E-52
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 151 506 2.0E-52
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 150 506 3.0E-52
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 149 502 3.0E-52
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 137 490 3.0E-52
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 151 533 3.0E-52
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 111 490 3.0E-52
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 151 524 4.0E-52
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 149 501 4.0E-52
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 150 506 4.0E-52
sp|A4REU9|MAK5_MAGO7 ATP-dependent RNA helicase MAK5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAK5 PE=3 SV=2 145 507 5.0E-52
sp|C3LQR1|RHLB_VIBCM ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rhlB PE=3 SV=1 151 501 5.0E-52
sp|Q9KV52|RHLB_VIBCH ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rhlB PE=3 SV=1 151 501 5.0E-52
sp|A5F3R4|RHLB_VIBC3 ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rhlB PE=3 SV=1 151 501 5.0E-52
sp|Q5VRY0|RH39_ORYSJ DEAD-box ATP-dependent RNA helicase 39 OS=Oryza sativa subsp. japonica GN=Os01g0184500 PE=2 SV=1 150 516 5.0E-52
sp|A7MXT4|RHLB_VIBCB ATP-dependent RNA helicase RhlB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rhlB PE=3 SV=1 151 527 5.0E-52
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 151 502 5.0E-52
sp|A3LX02|SPB4_PICST ATP-dependent rRNA helicase SPB4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SPB4 PE=3 SV=2 163 593 5.0E-52
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 136 558 5.0E-52
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 136 571 6.0E-52
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 151 502 7.0E-52
sp|Q87KH5|RHLB_VIBPA ATP-dependent RNA helicase RhlB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rhlB PE=3 SV=1 151 527 7.0E-52
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 150 502 8.0E-52
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 148 513 8.0E-52
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 148 513 9.0E-52
sp|Q8DDN6|RHLB_VIBVU ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain CMCP6) GN=rhlB PE=3 SV=1 151 527 9.0E-52
sp|Q5QYF8|RHLB_IDILO ATP-dependent RNA helicase RhlB OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rhlB PE=3 SV=1 151 524 9.0E-52
sp|Q7MGP7|RHLB_VIBVY ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain YJ016) GN=rhlB PE=3 SV=1 151 527 1.0E-51
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 110 514 1.0E-51
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 151 521 1.0E-51
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 151 527 1.0E-51
sp|A7TJK8|PRP5_VANPO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRP5 PE=3 SV=1 166 516 1.0E-51
sp|Q0U6X2|MAK5_PHANO ATP-dependent RNA helicase MAK5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MAK5 PE=3 SV=1 149 515 1.0E-51
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 149 502 1.0E-51
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 150 502 1.0E-51
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 149 501 1.0E-51
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 151 510 2.0E-51
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 148 513 2.0E-51
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 149 526 2.0E-51
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 151 516 2.0E-51
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 149 502 2.0E-51
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 150 502 2.0E-51
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 151 502 3.0E-51
sp|O01836|GLH3_CAEEL ATP-dependent RNA helicase glh-3 OS=Caenorhabditis elegans GN=glh-3 PE=1 SV=1 137 513 3.0E-51
sp|A5DLR3|DBP10_PICGU ATP-dependent RNA helicase DBP10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP10 PE=3 SV=2 141 513 3.0E-51
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 135 502 3.0E-51
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 169 493 3.0E-51
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 142 513 3.0E-51
sp|P0CR06|DBP10_CRYNJ ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP10 PE=3 SV=1 169 513 4.0E-51
sp|P0CR07|DBP10_CRYNB ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP10 PE=3 SV=1 169 513 4.0E-51
sp|B0TJ29|RHLB_SHEHH ATP-dependent RNA helicase RhlB OS=Shewanella halifaxensis (strain HAW-EB4) GN=rhlB PE=3 SV=1 151 524 4.0E-51
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 151 510 4.0E-51
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 151 510 4.0E-51
sp|Q6FML5|PRP5_CANGA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP5 PE=3 SV=1 148 508 4.0E-51
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 151 502 4.0E-51
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 144 514 4.0E-51
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 151 514 5.0E-51
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 151 524 5.0E-51
sp|A8GZJ0|RHLB_SHEPA ATP-dependent RNA helicase RhlB OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rhlB PE=3 SV=1 151 524 5.0E-51
sp|Q26696|DDX17_TRYBB Putative DEAD-box RNA helicase HEL64 OS=Trypanosoma brucei brucei GN=HEL64 PE=3 SV=1 113 506 5.0E-51
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 142 502 5.0E-51
sp|A3Q9R3|RHLB_SHELP ATP-dependent RNA helicase RhlB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rhlB PE=3 SV=1 151 527 6.0E-51
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 165 592 6.0E-51
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 122 490 6.0E-51
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 151 502 8.0E-51
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 150 493 8.0E-51
sp|Q91372|DDX4_XENLA Probable ATP-dependent RNA helicase DDX4 OS=Xenopus laevis GN=ddx4 PE=2 SV=1 87 502 8.0E-51
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 132 501 9.0E-51
sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 143 501 9.0E-51
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 150 501 9.0E-51
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 148 513 1.0E-50
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 131 510 1.0E-50
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 151 506 1.0E-50
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 151 502 1.0E-50
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 165 540 1.0E-50
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 151 510 1.0E-50
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 141 501 2.0E-50
sp|Q6BSM3|SPB4_DEBHA ATP-dependent rRNA helicase SPB4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPB4 PE=3 SV=1 163 593 2.0E-50
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 173 526 2.0E-50
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 141 506 3.0E-50
sp|Q2U5A2|DHH1_ASPOR ATP-dependent RNA helicase dhh1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dhh1 PE=3 SV=1 137 490 3.0E-50
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 135 502 3.0E-50
sp|Q9BQ39|DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo sapiens GN=DDX50 PE=1 SV=1 151 513 3.0E-50
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 150 502 3.0E-50
sp|Q750F8|SPB4_ASHGO ATP-dependent rRNA helicase SPB4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPB4 PE=3 SV=2 163 591 4.0E-50
sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 137 490 4.0E-50
sp|Q99MJ9|DDX50_MOUSE ATP-dependent RNA helicase DDX50 OS=Mus musculus GN=Ddx50 PE=2 SV=1 151 513 4.0E-50
sp|Q3B8Q1|DDX21_RAT Nucleolar RNA helicase 2 OS=Rattus norvegicus GN=Ddx21 PE=2 SV=1 143 501 4.0E-50
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 151 494 4.0E-50
sp|Q9JIK5|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus GN=Ddx21 PE=1 SV=3 143 501 5.0E-50
sp|Q0CBE1|DHH1_ASPTN ATP-dependent RNA helicase dhh1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dhh1 PE=3 SV=1 137 490 5.0E-50
sp|A2QY39|DHH1_ASPNC ATP-dependent RNA helicase dhh1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dhh1 PE=3 SV=1 137 490 5.0E-50
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 144 502 5.0E-50
sp|Q2UMY7|MAK5_ASPOR ATP-dependent RNA helicase mak5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mak5 PE=3 SV=1 49 558 5.0E-50
sp|A1D8G1|DHH1_NEOFI ATP-dependent RNA helicase dhh1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dhh1 PE=3 SV=1 137 490 6.0E-50
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 169 501 6.0E-50
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 137 502 6.0E-50
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 139 534 6.0E-50
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1929
MAMMNKKRKRAAGDASTADTTAVARTLKKMKNPAHAPKLQDEQDENDDRSEGEGSDAGSDESEGSESGAVDDELG
SSEEAQGQEEEEEEEEEEGEEEEEGEEEEEEDEEDEEEEKEENEEEDEDEDDQDCKDLPGDRPPTLPPSASDAST
FAELKLSEKTVKAIDEMGFTQMTAIQRSAIPPLLAGKDVLGAAKTGSGKTLAFLIPAIEIISALRFKPRNGTGVI
VVSPTRELALQIFGVARELMKHHSQTYGIVIGGANRKAEAEKLSKGVNLLIATPGRLLDHLLNTRFVFKNLKSLV
IDEADRILEVGFEDEIRQIVKVLANDDRQTMLFSATQTTKVEDLARISLRPGPLYINVDEEKQYSTVEGLEQGYL
LCDADKRFLLLFTFLKKMQKSKKKVIVFFSSCNSVKYYGELLNYIDCPVLDLHGKQKQQKRTNTFFEFSNAQQGI
LICTDVAARGLDIPAVDYIVQFDPPDNTRDYIHRVGRTARGANAKGRSIMFLLPNEVGFISHLKAARVPVVEFEL
KADKIINVQSQLEKLISKNYYLNQSAKDAFKSYIHAYASHSLRSIYDVNKLDLIKLAKSFGFTTPPRVDITLGAS
MGKKKVQGRRAYGSQPRQVDYKRKRG*
Coding >OphauB2|1929
ATGGCCATGATGAACAAGAAGCGCAAGCGCGCTGCTGGCGATGCATCCACGGCCGACACCACCGCCGTGGCTAGG
ACATTGAAAAAGATGAAGAATCCCGCACACGCGCCGAAGCTGCAAGACGAACAAGACGAGAATGATGACAGGAGT
GAGGGAGAGGGTAGCGATGCTGGCTCAGACGAGTCTGAAGGGTCGGAATCTGGAGCAGTGGATGATGAATTAGGC
TCGAGCGAGGAGGCACAAGGGCAAGAAGAGGAAGAGGAAGAAGAAGAGGAAGAGGGAGAAGAAGAGGAAGAGGGA
GAAGAAGAGGAAGAGGAAGATGAAGAGGATGAAGAAGAGGAAAAAGAAGAGAATGAAGAAGAGGACGAGGATGAA
GACGACCAAGATTGCAAAGACTTGCCCGGAGATAGGCCGCCCACACTGCCGCCGTCTGCCTCGGACGCATCAACA
TTTGCCGAGTTGAAACTGTCAGAAAAGACTGTCAAGGCTATAGACGAGATGGGATTCACACAAATGACTGCCATT
CAACGCAGCGCCATCCCCCCCCTCCTTGCGGGCAAAGACGTGCTCGGCGCCGCAAAGACGGGCTCGGGCAAAACG
CTTGCTTTCCTCATCCCCGCCATTGAGATTATCAGCGCGCTGCGATTTAAGCCGAGAAACGGCACGGGCGTCATT
GTGGTATCGCCGACGCGAGAACTTGCGCTGCAAATCTTTGGTGTTGCCAGGGAACTCATGAAGCATCATTCTCAA
ACATACGGCATTGTCATTGGCGGGGCGAATAGAAAGGCGGAAGCAGAGAAGCTGTCCAAGGGCGTTAATCTCTTG
ATTGCAACGCCTGGAAGGCTGTTGGATCATTTGCTCAATACTCGGTTTGTCTTTAAGAATCTCAAGTCTCTGGTC
ATTGACGAGGCGGATCGGATACTTGAAGTTGGATTCGAGGATGAGATTCGGCAAATTGTAAAGGTGCTTGCCAAT
GACGACCGTCAGACGATGCTCTTTTCGGCTACTCAAACGACAAAAGTTGAGGATCTGGCTAGAATCTCGTTGCGG
CCTGGGCCACTCTACATTAATGTGGATGAGGAAAAACAGTATAGTACCGTCGAGGGTCTTGAACAGGGCTACCTG
CTATGCGATGCCGACAAACGCTTCTTGCTCCTCTTTACATTTCTGAAAAAGATGCAAAAGAGCAAGAAAAAGGTC
ATCGTCTTCTTTAGCAGCTGCAACTCGGTCAAGTACTATGGCGAACTCCTCAACTACATTGACTGTCCTGTGCTG
GACCTGCACGGCAAGCAGAAGCAGCAGAAGCGCACAAACACCTTTTTCGAGTTTAGCAACGCGCAACAGGGCATC
TTGATTTGCACCGATGTGGCTGCGCGTGGACTCGATATTCCTGCTGTCGACTATATTGTTCAGTTTGACCCTCCA
GACAACACGCGCGATTATATTCACCGCGTGGGACGGACGGCGCGAGGTGCCAATGCCAAGGGCCGGAGCATCATG
TTTTTGCTGCCCAACGAAGTCGGCTTCATCTCACACCTCAAGGCGGCGCGCGTGCCTGTCGTTGAGTTTGAGCTC
AAGGCGGACAAGATTATCAATGTGCAGTCACAGCTTGAGAAGCTCATTAGCAAGAACTATTACCTCAACCAGAGC
GCCAAGGACGCCTTCAAGTCGTATATCCACGCCTATGCCAGCCACAGCCTGCGGTCCATCTATGATGTGAACAAG
CTCGACCTGATTAAGCTGGCCAAGAGCTTTGGCTTTACGACGCCGCCTCGCGTGGACATTACTCTTGGTGCGTCA
ATGGGCAAGAAGAAGGTGCAGGGGAGAAGGGCATATGGCAGTCAGCCTCGGCAAGTGGATTATAAAAGGAAGAGA
GGCTAG
Transcript >OphauB2|1929
ATGGCCATGATGAACAAGAAGCGCAAGCGCGCTGCTGGCGATGCATCCACGGCCGACACCACCGCCGTGGCTAGG
ACATTGAAAAAGATGAAGAATCCCGCACACGCGCCGAAGCTGCAAGACGAACAAGACGAGAATGATGACAGGAGT
GAGGGAGAGGGTAGCGATGCTGGCTCAGACGAGTCTGAAGGGTCGGAATCTGGAGCAGTGGATGATGAATTAGGC
TCGAGCGAGGAGGCACAAGGGCAAGAAGAGGAAGAGGAAGAAGAAGAGGAAGAGGGAGAAGAAGAGGAAGAGGGA
GAAGAAGAGGAAGAGGAAGATGAAGAGGATGAAGAAGAGGAAAAAGAAGAGAATGAAGAAGAGGACGAGGATGAA
GACGACCAAGATTGCAAAGACTTGCCCGGAGATAGGCCGCCCACACTGCCGCCGTCTGCCTCGGACGCATCAACA
TTTGCCGAGTTGAAACTGTCAGAAAAGACTGTCAAGGCTATAGACGAGATGGGATTCACACAAATGACTGCCATT
CAACGCAGCGCCATCCCCCCCCTCCTTGCGGGCAAAGACGTGCTCGGCGCCGCAAAGACGGGCTCGGGCAAAACG
CTTGCTTTCCTCATCCCCGCCATTGAGATTATCAGCGCGCTGCGATTTAAGCCGAGAAACGGCACGGGCGTCATT
GTGGTATCGCCGACGCGAGAACTTGCGCTGCAAATCTTTGGTGTTGCCAGGGAACTCATGAAGCATCATTCTCAA
ACATACGGCATTGTCATTGGCGGGGCGAATAGAAAGGCGGAAGCAGAGAAGCTGTCCAAGGGCGTTAATCTCTTG
ATTGCAACGCCTGGAAGGCTGTTGGATCATTTGCTCAATACTCGGTTTGTCTTTAAGAATCTCAAGTCTCTGGTC
ATTGACGAGGCGGATCGGATACTTGAAGTTGGATTCGAGGATGAGATTCGGCAAATTGTAAAGGTGCTTGCCAAT
GACGACCGTCAGACGATGCTCTTTTCGGCTACTCAAACGACAAAAGTTGAGGATCTGGCTAGAATCTCGTTGCGG
CCTGGGCCACTCTACATTAATGTGGATGAGGAAAAACAGTATAGTACCGTCGAGGGTCTTGAACAGGGCTACCTG
CTATGCGATGCCGACAAACGCTTCTTGCTCCTCTTTACATTTCTGAAAAAGATGCAAAAGAGCAAGAAAAAGGTC
ATCGTCTTCTTTAGCAGCTGCAACTCGGTCAAGTACTATGGCGAACTCCTCAACTACATTGACTGTCCTGTGCTG
GACCTGCACGGCAAGCAGAAGCAGCAGAAGCGCACAAACACCTTTTTCGAGTTTAGCAACGCGCAACAGGGCATC
TTGATTTGCACCGATGTGGCTGCGCGTGGACTCGATATTCCTGCTGTCGACTATATTGTTCAGTTTGACCCTCCA
GACAACACGCGCGATTATATTCACCGCGTGGGACGGACGGCGCGAGGTGCCAATGCCAAGGGCCGGAGCATCATG
TTTTTGCTGCCCAACGAAGTCGGCTTCATCTCACACCTCAAGGCGGCGCGCGTGCCTGTCGTTGAGTTTGAGCTC
AAGGCGGACAAGATTATCAATGTGCAGTCACAGCTTGAGAAGCTCATTAGCAAGAACTATTACCTCAACCAGAGC
GCCAAGGACGCCTTCAAGTCGTATATCCACGCCTATGCCAGCCACAGCCTGCGGTCCATCTATGATGTGAACAAG
CTCGACCTGATTAAGCTGGCCAAGAGCTTTGGCTTTACGACGCCGCCTCGCGTGGACATTACTCTTGGTGCGTCA
ATGGGCAAGAAGAAGGTGCAGGGGAGAAGGGCATATGGCAGTCAGCCTCGGCAAGTGGATTATAAAAGGAAGAGA
GGCTAG
Gene >OphauB2|1929
ATGGCCATGATGAACAAGAAGCGCAAGCGCGCTGCTGGCGATGCATCCACGGCCGACACCACCGCCGTGGCTAGG
ACATTGAAAAAGATGAAGAATCCCGCACACGCGCCGAAGCTGCAAGACGAACAAGACGAGAATGATGACAGGAGT
GAGGGAGAGGGTAGCGATGCTGGCTCAGACGAGTCTGAAGGGTCGGAATCTGGAGCAGTGGATGATGAATTAGGC
TCGAGCGAGGAGGCACAAGGGCAAGAAGAGGAAGAGGAAGAAGAAGAGGAAGAGGGAGAAGAAGAGGAAGAGGGA
GAAGAAGAGGAAGAGGAAGATGAAGAGGATGAAGAAGAGGAAAAAGAAGAGAATGAAGAAGAGGACGAGGATGAA
GACGACCAAGATTGCAAAGACTTGCCCGGAGATAGGCCGCCCACACTGCCGCCGTCTGCCTCGGACGCATCAACA
TTTGCCGAGTTGAAACTGTCAGAAAAGACTGTCAAGGCTATAGACGAGATGGGATTCACACAAATGACTGCCATT
CAACGCAGCGTAAGCCCATCCGACTTGTGCTCCAATCCCCTTTGCTAACCAAGACAGGCCATCCCCCCCCTCCTT
GCGGGCAAAGACGTGCTCGGCGCCGCAAAGACGGGCTCGGGCAAAACGCTTGCTTTCCTCATCCCCGCCATTGAG
ATTATCAGCGCGCTGCGATTTAAGCCGAGAAACGGCACGGGCGTCATTGTGGTATCGCCGACGCGAGAACTTGCG
CTGCAAATCTTTGGTGTTGCCAGGGAACTCATGAAGCATCATTCTCAAACATACGGCATTGTCATTGGCGGGGCG
AATAGAAAGGCGGAAGCAGAGAAGCTGTCCAAGGGCGTTAATCTCTTGATTGCAACGCCTGGAAGGCTGTTGGAT
CATTTGCTCAATACTCGGTTTGTCTTTAAGAATCTCAAGTCTCTGGTCATTGACGAGGCGGATCGGATACTTGAA
GTTGGATTCGAGGATGAGATTCGGCAAATTGTAAAGGTGCTTGCCAATGACGACCGTCAGACGATGCTCTTTTCG
GCTACTCAAACGACAAAAGTTGGTAGGTGCTTCCTCTCTATCCAGCTCTGGTCGACTGGCTCCTGCGTCTGCTCA
ATTACCCTTTGTACCTTGACGCAAGTCTGGGCTAACGATTGGTCGCTTGATGGCCTTTATTACAGAGGATCTGGC
TAGAATCTCGTTGCGGCCTGGGCCACTCTACATTAATGTGGATGAGGAAAAACAGTATAGTACCGTCGAGGGTCT
TGAACAGGGCTACCTGCTATGCGATGCCGACAAACGCTTCTTGCTCCTCTTTACATTTCTGAAAAAGATGCAAAA
GAGCAAGAAAAAGGTCATCGTCTTCTTTAGCAGCTGCAACTCGGTCAAGTACTATGGCGAACTCCTCAACTACAT
TGACTGTCCTGTGCTGGACCTGCACGGCAAGCAGAAGCAGCAGAAGCGCACAAACACCTTTTTCGAGTTTAGCAA
CGCGCAACAGGGCATCTTGATTTGCACCGATGTGGCTGCGCGTGGACTCGATGTGAGCATGGCATAATTGTCAAG
GGGCTAGAGCCAGGCATGCTAATACTTTTGTAGATTCCTGCTGTCGACTATATTGTTCAGTTTGACCCTCCAGAC
AACACGCGCGATTATATTCACCGCGTGGGACGGACGGCGCGAGGTGCCAATGCCAAGGGCCGGAGCATCATGTTT
TTGCTGCCCAACGAAGTCGGCTTCATCTCACACCTCAAGGCGGCGCGCGTGCCTGTCGTTGAGTTTGAGCTCAAG
GCGGACAAGATTATCAATGTGCAGTCACAGCTTGAGAAGCTCATTAGCAAGAACTATTACCTCAACCAGAGCGCC
AAGGACGCCTTCAAGTCGTATATCCACGCCTATGCCAGCCACAGCCTGCGGTCCATCTATGATGTGAACAAGCTC
GACCTGATTAAGCTGGCCAAGAGCTTTGGCTTTACGACGCCGCCTCGCGTGGACATTACTCTTGGTGCGTCAATG
GGCAAGAAGAAGGTGCAGGGGAGAAGGGCATATGGCAGTCAGCCTCGGCAAGTGGATTATAAAAGGAAGAGAGGC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail