Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1919
Gene name
LocationContig_156:36628..37195
Strand-
Gene length (bp)567
Transcript length (bp)567
Coding sequence length (bp)567
Protein length (aa) 189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 3.9E-12 58 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 52 185 1.0E-32
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 56 185 4.0E-30
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 52 185 9.0E-30
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 52 188 1.0E-27
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 49 185 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 52 185 1.0E-32
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 56 185 4.0E-30
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 52 185 9.0E-30
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 52 188 1.0E-27
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 49 185 3.0E-22
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 51 178 2.0E-21
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 51 188 6.0E-21
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 57 178 2.0E-20
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 9 178 5.0E-20
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 61 178 2.0E-19
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 51 185 5.0E-19
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 57 178 1.0E-18
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 56 187 1.0E-18
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 57 178 7.0E-18
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 4 174 2.0E-17
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 52 188 3.0E-17
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 61 178 2.0E-16
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 61 178 2.0E-16
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 74 178 2.0E-15
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 61 178 2.0E-15
sp|Q5AB48|RBT4_CANAL Secreted protein RBT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT4 PE=1 SV=2 43 177 3.0E-15
sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 52 188 5.0E-15
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 61 187 2.0E-13
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 6 185 3.0E-13
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 61 178 1.0E-12
sp|P04284|PR06_SOLLC Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum GN=PR1B1 PE=1 SV=2 57 178 5.0E-12
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 57 178 5.0E-12
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 57 178 1.0E-11
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 57 185 3.0E-11
sp|P35782|VA52_VESCR Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1 72 175 3.0E-09
sp|B3EWZ8|ECT_ACRMI Ectin (Fragment) OS=Acropora millepora PE=1 SV=1 47 183 3.0E-09
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 56 178 5.0E-09
sp|Q6UXB8|PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens GN=PI16 PE=1 SV=1 56 178 2.0E-08
sp|Q05108|VA5_DOLAR Venom allergen 5 OS=Dolichovespula arenaria PE=1 SV=1 72 178 2.0E-08
sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus GN=PI16 PE=2 SV=1 72 178 3.0E-08
sp|P35781|VA51_VESCR Venom allergen 5.01 OS=Vespa crabro PE=1 SV=1 72 175 4.0E-08
sp|Q2XXQ1|CRVP_LEIMD Cysteine-rich venom protein LEI1 (Fragment) OS=Leioheterodon madagascariensis PE=1 SV=1 81 180 4.0E-08
sp|P35785|VA5_VESPE Venom allergen 5 OS=Vespula pensylvanica PE=1 SV=1 70 174 2.0E-07
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 5 174 2.0E-07
sp|B3A0P7|SCP1_LOTGI SCP domain-containing protein 1 OS=Lottia gigantea PE=1 SV=1 62 187 2.0E-07
sp|P35783|VA5_VESFL Venom allergen 5 OS=Vespula flavopilosa PE=1 SV=1 70 178 3.0E-07
sp|P86870|VA5_VESMG Venom allergen 5 OS=Vespa magnifica PE=1 SV=2 72 175 4.0E-07
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 62 177 4.0E-07
sp|P35784|VA5_VESGE Venom allergen 5 OS=Vespula germanica PE=1 SV=1 70 174 6.0E-07
sp|Q6UWM5|GPRL1_HUMAN GLIPR1-like protein 1 OS=Homo sapiens GN=GLIPR1L1 PE=1 SV=2 101 174 7.0E-07
sp|P86686|VA5_POLPI Venom allergen 5 OS=Polybia paulista PE=1 SV=1 72 177 7.0E-07
sp|Q05110|VA5_VESVU Venom allergen 5 OS=Vespula vulgaris PE=1 SV=1 70 178 7.0E-07
sp|Q7Z156|VA5_POLSR Venom allergen 5 OS=Polybia scutellaris rioplatensis PE=1 SV=2 72 178 9.0E-07
sp|Q32LB5|GPRL1_BOVIN GLIPR1-like protein 1 OS=Bos taurus GN=GLIPR1L1 PE=2 SV=1 101 174 2.0E-06
sp|Q7ZT98|CRVP_OPHHA Cysteine-rich venom protein ophanin OS=Ophiophagus hannah PE=1 SV=1 115 180 2.0E-06
sp|P35759|VA5_POLEX Venom allergen 5 OS=Polistes exclamans PE=1 SV=2 72 179 2.0E-06
sp|Q2XXP1|CRVPB_VARVA Cysteine-rich venom protein VAR11 OS=Varanus varius PE=2 SV=1 112 178 2.0E-06
sp|F8J2D4|CRVP_DRYCN Cysteine-rich venom protein OS=Drysdalia coronoides PE=1 SV=1 72 180 3.0E-06
sp|Q2XXP2|CRVPA_VARVA Cysteine-rich venom protein VAR10 (Fragment) OS=Varanus varius PE=2 SV=1 112 178 4.0E-06
sp|Q05109|VA5_POLAN Venom allergen 5 (Fragment) OS=Polistes annularis PE=1 SV=1 72 179 5.0E-06
sp|F8S0Y4|CRVP_CROAD Cysteine-rich secretory protein OS=Crotalus adamanteus PE=1 SV=1 101 180 5.0E-06
sp|Q3SB04|CRVP_NOTSC Cysteine-rich venom protein pseudechetoxin-like OS=Notechis scutatus scutatus PE=2 SV=1 10 180 6.0E-06
sp|Q3SB03|CRVP_HOPST Cysteine-rich venom protein pseudechetoxin-like OS=Hoplocephalus stephensii PE=2 SV=1 10 180 6.0E-06
sp|A8S6B6|CRVP_AUSSU Cysteine-rich venom protein OS=Austrelaps superbus PE=2 SV=1 10 180 6.0E-06
sp|Q7T1K6|CRVP1_NAJAT Cysteine-rich venom protein natrin-1 OS=Naja atra PE=1 SV=1 89 180 6.0E-06
sp|P81657|VA5_VESMA Venom allergen 5 OS=Vespa mandarinia PE=1 SV=1 72 175 7.0E-06
sp|P35760|VA5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=1 SV=1 70 178 7.0E-06
sp|Q09GJ9|CRVP_PHIOL Cysteine-rich venom protein OS=Philodryas olfersii PE=2 SV=1 91 180 7.0E-06
sp|P84805|CRVP1_NAJKA Cysteine-rich venom protein kaouthin-1 OS=Naja kaouthia PE=1 SV=2 89 180 8.0E-06
sp|Q8JI40|CRVP_GLOBL Cysteine-rich venom protein ablomin OS=Gloydius blomhoffii PE=1 SV=1 102 180 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1919
MKSSFLFLSLVLITISQLVFAAPAPADNAEEPQDNSNGASPTDRAWVNEGAFESGILGVTNQYRAQHGARPLQWN
SSLAWWAYGYLDRNKCAWKHSQGPWGENIACGYVTPAHSVKIWGDERRAYDYRHPGFTHETGHFTQLVWKGTTDV
GCAREWCGRYMRWFVACEYWPPGNVQGQFAQNVSPQRR*
Coding >OphauB2|1919
ATGAAGTCCTCGTTCCTCTTCTTGTCTCTGGTGCTCATCACCATCTCTCAGCTGGTCTTTGCGGCTCCTGCCCCT
GCCGACAATGCAGAAGAGCCTCAAGACAATTCCAACGGGGCCTCGCCTACCGACCGTGCCTGGGTCAACGAAGGT
GCCTTTGAGTCTGGTATTCTCGGCGTCACGAACCAATACCGCGCTCAGCACGGGGCTCGCCCCTTGCAATGGAAC
TCCTCCCTCGCTTGGTGGGCATATGGCTACCTGGACCGCAACAAGTGCGCTTGGAAGCATTCTCAGGGGCCCTGG
GGCGAGAATATCGCCTGTGGTTATGTGACTCCAGCACACAGTGTCAAAATTTGGGGTGACGAGCGCCGCGCCTAT
GATTACCGTCATCCAGGCTTCACCCACGAAACAGGTCATTTCACGCAGCTCGTGTGGAAAGGCACGACTGACGTG
GGTTGCGCCCGAGAGTGGTGTGGTCGTTACATGCGTTGGTTTGTCGCCTGCGAGTATTGGCCTCCGGGCAATGTG
CAAGGCCAATTTGCCCAGAATGTGTCTCCCCAGAGGCGGTGA
Transcript >OphauB2|1919
ATGAAGTCCTCGTTCCTCTTCTTGTCTCTGGTGCTCATCACCATCTCTCAGCTGGTCTTTGCGGCTCCTGCCCCT
GCCGACAATGCAGAAGAGCCTCAAGACAATTCCAACGGGGCCTCGCCTACCGACCGTGCCTGGGTCAACGAAGGT
GCCTTTGAGTCTGGTATTCTCGGCGTCACGAACCAATACCGCGCTCAGCACGGGGCTCGCCCCTTGCAATGGAAC
TCCTCCCTCGCTTGGTGGGCATATGGCTACCTGGACCGCAACAAGTGCGCTTGGAAGCATTCTCAGGGGCCCTGG
GGCGAGAATATCGCCTGTGGTTATGTGACTCCAGCACACAGTGTCAAAATTTGGGGTGACGAGCGCCGCGCCTAT
GATTACCGTCATCCAGGCTTCACCCACGAAACAGGTCATTTCACGCAGCTCGTGTGGAAAGGCACGACTGACGTG
GGTTGCGCCCGAGAGTGGTGTGGTCGTTACATGCGTTGGTTTGTCGCCTGCGAGTATTGGCCTCCGGGCAATGTG
CAAGGCCAATTTGCCCAGAATGTGTCTCCCCAGAGGCGGTGA
Gene >OphauB2|1919
ATGAAGTCCTCGTTCCTCTTCTTGTCTCTGGTGCTCATCACCATCTCTCAGCTGGTCTTTGCGGCTCCTGCCCCT
GCCGACAATGCAGAAGAGCCTCAAGACAATTCCAACGGGGCCTCGCCTACCGACCGTGCCTGGGTCAACGAAGGT
GCCTTTGAGTCTGGTATTCTCGGCGTCACGAACCAATACCGCGCTCAGCACGGGGCTCGCCCCTTGCAATGGAAC
TCCTCCCTCGCTTGGTGGGCATATGGCTACCTGGACCGCAACAAGTGCGCTTGGAAGCATTCTCAGGGGCCCTGG
GGCGAGAATATCGCCTGTGGTTATGTGACTCCAGCACACAGTGTCAAAATTTGGGGTGACGAGCGCCGCGCCTAT
GATTACCGTCATCCAGGCTTCACCCACGAAACAGGTCATTTCACGCAGCTCGTGTGGAAAGGCACGACTGACGTG
GGTTGCGCCCGAGAGTGGTGTGGTCGTTACATGCGTTGGTTTGTCGCCTGCGAGTATTGGCCTCCGGGCAATGTG
CAAGGCCAATTTGCCCAGAATGTGTCTCCCCAGAGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail