Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1914
Gene name
LocationContig_156:26023..26992
Strand-
Gene length (bp)969
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02585 PIG-L GlcNAc-PI de-N-acetylase 1.8E-28 40 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 34 280 7.0E-71
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 38 279 2.0E-43
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 39 278 5.0E-43
sp|O35790|PIGL_RAT N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Rattus norvegicus GN=Pigl PE=2 SV=1 38 279 5.0E-43
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 22 277 3.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4K9|GPI12_ARTBC N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03399 PE=3 SV=1 34 280 7.0E-71
sp|Q5SX19|PIGL_MOUSE N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Mus musculus GN=Pigl PE=2 SV=1 38 279 2.0E-43
sp|Q9HDW9|GPI12_SCHPO Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi12 PE=3 SV=1 39 278 5.0E-43
sp|O35790|PIGL_RAT N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Rattus norvegicus GN=Pigl PE=2 SV=1 38 279 5.0E-43
sp|Q54C64|PIGL_DICDI Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Dictyostelium discoideum GN=pigl PE=3 SV=1 22 277 3.0E-40
sp|Q9Y2B2|PIGL_HUMAN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Homo sapiens GN=PIGL PE=1 SV=1 38 277 1.0E-37
sp|A6QQ24|PIGL_BOVIN N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Bos taurus GN=PIGL PE=2 SV=1 38 279 2.0E-34
sp|P23797|GPI12_YEAST N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI12 PE=1 SV=2 6 277 1.0E-31
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 2 21 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5516
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2104
Ophiocordyceps australis map64 (Brazil) OphauB2|1914 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01722
Ophiocordyceps kimflemingae Ophio5|7947
Ophiocordyceps subramaniannii Hirsu2|678

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1914
MGLGVVLVGALLVVLLPLAYHRSALLLEQPPAALRNRRICLVIAHPDDEAMFFAPTVQALARRSAGNHIKVLCLS
AGNAAGLGEIRKRELVESALLLGLRDADDVFVVDDGQAFPDSMTAAWAPDKIASLLASAFARPASPAVIDVLITF
DAHGVSGHANHIALYYGATRFARHLAATAQSNCRVDVYTLSSVAIARKYASVVDGLVTLLPPLLRRHGSVATPSL
SPQPYPQRLLFANSFTALPTAWRAMTQAHKSQMLWFRWLWILFSRYMLVNELRLEQLSEQGALDMQQDDASCLL*
Coding >OphauB2|1914
ATGGGCCTCGGCGTCGTCCTCGTCGGCGCGCTGCTCGTCGTCTTGTTGCCTCTGGCCTACCACCGCAGCGCGTTG
CTCCTGGAGCAGCCGCCGGCAGCGCTGCGCAACCGGCGCATCTGCCTCGTCATTGCACACCCCGACGACGAGGCC
ATGTTTTTTGCGCCCACGGTGCAGGCCCTGGCGCGTCGCAGCGCGGGCAACCACATCAAGGTGCTCTGCCTGAGC
GCGGGCAACGCGGCGGGCCTGGGCGAGATTCGCAAGCGCGAGCTGGTTGAGAGCGCGCTGCTGCTGGGGCTGCGC
GATGCCGACGACGTCTTTGTCGTTGATGATGGCCAAGCCTTTCCCGACTCCATGACGGCCGCCTGGGCCCCCGAC
AAAATCGCCTCGCTGCTCGCCAGCGCCTTTGCCCGTCCCGCCTCGCCCGCCGTCATTGATGTCCTCATCACCTTT
GACGCCCACGGCGTCTCGGGCCACGCCAACCACATTGCTCTCTACTACGGCGCCACCCGCTTTGCCCGCCATCTG
GCCGCCACTGCCCAGTCCAACTGCCGCGTCGATGTTTACACCCTCTCCTCCGTCGCCATTGCGCGCAAGTACGCA
TCTGTGGTCGACGGCCTCGTCACCCTGCTTCCCCCGCTTTTGCGCCGTCATGGCTCCGTCGCTACCCCGTCGCTG
TCGCCTCAACCATATCCCCAAAGGCTCCTTTTTGCCAACTCGTTTACTGCCCTGCCCACCGCCTGGCGTGCCATG
ACGCAAGCCCACAAGAGCCAGATGCTGTGGTTCCGCTGGCTGTGGATCCTCTTTAGCCGCTACATGCTGGTCAAT
GAGTTGCGTCTCGAGCAATTGTCAGAGCAAGGTGCCTTGGATATGCAACAAGATGATGCTTCTTGTTTGCTCTAG
Transcript >OphauB2|1914
ATGGGCCTCGGCGTCGTCCTCGTCGGCGCGCTGCTCGTCGTCTTGTTGCCTCTGGCCTACCACCGCAGCGCGTTG
CTCCTGGAGCAGCCGCCGGCAGCGCTGCGCAACCGGCGCATCTGCCTCGTCATTGCACACCCCGACGACGAGGCC
ATGTTTTTTGCGCCCACGGTGCAGGCCCTGGCGCGTCGCAGCGCGGGCAACCACATCAAGGTGCTCTGCCTGAGC
GCGGGCAACGCGGCGGGCCTGGGCGAGATTCGCAAGCGCGAGCTGGTTGAGAGCGCGCTGCTGCTGGGGCTGCGC
GATGCCGACGACGTCTTTGTCGTTGATGATGGCCAAGCCTTTCCCGACTCCATGACGGCCGCCTGGGCCCCCGAC
AAAATCGCCTCGCTGCTCGCCAGCGCCTTTGCCCGTCCCGCCTCGCCCGCCGTCATTGATGTCCTCATCACCTTT
GACGCCCACGGCGTCTCGGGCCACGCCAACCACATTGCTCTCTACTACGGCGCCACCCGCTTTGCCCGCCATCTG
GCCGCCACTGCCCAGTCCAACTGCCGCGTCGATGTTTACACCCTCTCCTCCGTCGCCATTGCGCGCAAGTACGCA
TCTGTGGTCGACGGCCTCGTCACCCTGCTTCCCCCGCTTTTGCGCCGTCATGGCTCCGTCGCTACCCCGTCGCTG
TCGCCTCAACCATATCCCCAAAGGCTCCTTTTTGCCAACTCGTTTACTGCCCTGCCCACCGCCTGGCGTGCCATG
ACGCAAGCCCACAAGAGCCAGATGCTGTGGTTCCGCTGGCTGTGGATCCTCTTTAGCCGCTACATGCTGGTCAAT
GAGTTGCGTCTCGAGCAATTGTCAGAGCAAGGTGCCTTGGATATGCAACAAGATGATGCTTCTTGTTTGCTCTAG
Gene >OphauB2|1914
ATGGGCCTCGGCGTCGTCCTCGTCGGCGCGCTGCTCGTCGTCTTGTTGCCTCTGGCCTACCACCGCAGCGCGTTG
CTCCTGGAGCAGCCGCCGGCAGCGCTGCGCAACCGGCGCATCTGCCTCGTCATTGCACACCCCGACGACGAGGCC
ATGTTTTTTGCGCCCACGGTGCAGGCCCTGGCGCGTCGCAGCGCGGGCAACCACATCAAGGTGCTCTGCCTGAGC
GCGGGCAACGCGGCGGGCCTGGGCGAGATTCGCAAGCGCGAGCTGGTTGAGAGCGCGCTGCTGCTGGGGCTGCGC
GATGCCGACGACGTCTTTGTCGTTGATGATGGGTGCGTTGATGGTCTCCTTGTCCTTTTTGCTTGCTTGCCTGTC
TGTCGGCCCAGCGCTCACGGCCCCAGCCAAGCCTTTCCCGACTCCATGACGGCCGCCTGGGCCCCCGACAAAATC
GCCTCGCTGCTCGCCAGCGCCTTTGCCCGTCCCGCCTCGCCCGCCGTCATTGATGTCCTCATCACCTTTGACGCC
CACGGCGTCTCGGGCCACGCCAACCACATTGCTCTCTACTACGGCGCCACCCGCTTTGCCCGCCATCTGGCCGCC
ACTGCCCAGTCCAACTGCCGCGTCGATGTTTACACCCTCTCCTCCGTCGCCATTGCGCGCAAGTACGCATCTGTG
GTCGACGGCCTCGTCACCCTGCTTCCCCCGCTTTTGCGCCGTCATGGCTCCGTCGCTACCCCGTCGCTGTCGCCT
CAACCATATCCCCAAAGGCTCCTTTTTGCCAACTCGTTTACTGCCCTGCCCACCGCCTGGCGTGCCATGACGCAA
GCCCACAAGAGCCAGATGCTGTGGTTCCGCTGGCTGTGGATCCTCTTTAGCCGCTACATGCTGGTCAATGAGTTG
CGTCTCGAGCAATTGTCAGAGCAAGGTGCCTTGGATATGCAACAAGATGATGCTTCTTGTTTGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail