Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1911
Gene name
LocationContig_156:20076..21692
Strand+
Gene length (bp)1616
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07647 SAM_2 SAM domain (Sterile alpha motif) 6.4E-15 68 128
PF00536 SAM_1 SAM domain (Sterile alpha motif) 4.9E-13 66 127
PF00788 RA Ras association (RalGDS/AF-6) domain 1.6E-11 383 456

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25344|STE50_YEAST Protein STE50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE50 PE=1 SV=1 295 454 6.0E-15
sp|B4PRE2|DGKH_DROYA Diacylglycerol kinase eta OS=Drosophila yakuba GN=GE24946 PE=3 SV=2 66 128 5.0E-07
sp|B3LXF2|DGKH_DROAN Diacylglycerol kinase eta OS=Drosophila ananassae GN=GF18176 PE=3 SV=2 66 128 7.0E-07
sp|A8JQ65|DGKH_DROME Diacylglycerol kinase eta OS=Drosophila melanogaster GN=CG34384 PE=2 SV=1 66 128 1.0E-06

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0007165 signal transduction Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2147
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2118
Ophiocordyceps australis map64 (Brazil) OphauB2|1911 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01724
Ophiocordyceps camponoti-rufipedis Ophun1|5739
Ophiocordyceps kimflemingae Ophio5|7944
Ophiocordyceps subramaniannii Hirsu2|2599

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1911
MGFDGGTAYAESDADDEYERSIGDRSPVGDSEASPIESEPPASAEHTPTTYGQRSAADRLPETVISDWTTDECAD
FIGTIGLPQYADRFVDNEIVGEALVALLHDDLKTMGIASVGHRLTILKSVYDVKRAQDVPIESDHYYPLSADAEA
QYATATLKDIKHLVEQLRLRDERMSLLEQDVRRMNDDFRRLREDMLPALRLAKDAQQPLPNVSNSTQAYSHEPTV
SPPAPTPNPGQGPGAGMMRSFSQRKILIGATPKGTSPTQPTHERTIAEQTLDAASAAERAAMAPSHLTALNGSGQ
ISSSYPSPNNPSPTSPQTHLGGATLASRSYRGESSTTSSRANLNDADYASYGSRDKTPGAAPPRRRETPVPDTPS
TSNASVEIFKSFRVSMDDPCYKVLPAALKKYQINAPWDQYALYIVYGDQERCLGMDEKPLILFKQLDKEGKKPMF
MLRKTNNAPVDSDPGSAGMGGAARGQATGYDPPGGII*
Coding >OphauB2|1911
ATGGGCTTCGACGGCGGCACAGCCTACGCCGAGTCGGACGCCGATGACGAGTATGAACGCAGCATCGGCGACCGT
TCTCCAGTTGGCGACTCGGAAGCATCGCCCATTGAGTCGGAGCCGCCGGCCTCGGCCGAGCACACGCCCACGACG
TACGGCCAACGCAGCGCGGCAGACCGGCTGCCAGAGACAGTCATTAGTGACTGGACAACGGACGAGTGTGCCGAC
TTTATTGGCACCATCGGCTTGCCGCAGTACGCCGATCGTTTTGTCGACAATGAAATCGTGGGCGAGGCCCTGGTG
GCGCTGCTGCACGACGACCTCAAGACCATGGGGATTGCCAGTGTCGGCCACCGCCTGACCATCCTCAAGAGCGTC
TACGATGTCAAGAGGGCCCAAGATGTGCCGATTGAGAGCGATCACTACTATCCCTTGTCTGCCGATGCTGAGGCT
CAGTATGCCACTGCTACGCTCAAGGACATTAAGCATCTGGTTGAGCAGCTGCGACTGCGAGACGAGCGAATGAGC
TTGCTGGAGCAAGACGTACGGCGCATGAATGATGATTTTCGGCGTCTAAGAGAAGACATGCTGCCGGCGCTGCGC
CTGGCCAAGGACGCCCAGCAGCCCTTGCCCAATGTCAGCAATAGCACGCAAGCCTACAGCCACGAGCCGACAGTC
TCGCCGCCTGCTCCAACACCAAACCCAGGCCAGGGCCCCGGTGCTGGCATGATGCGCTCCTTTTCTCAGAGAAAA
ATATTGATTGGTGCAACTCCCAAGGGTACCTCGCCGACGCAGCCGACACACGAAAGAACGATAGCAGAGCAAACG
CTAGATGCAGCCAGTGCAGCGGAGCGAGCTGCCATGGCTCCGTCGCACTTGACTGCCTTGAACGGCAGCGGACAG
ATTTCATCGTCATACCCCTCGCCCAACAATCCTTCACCAACCTCACCTCAAACCCATTTGGGCGGAGCAACGCTG
GCATCGAGATCGTACCGAGGCGAGTCATCAACAACATCTAGCAGGGCAAACCTCAATGATGCAGACTATGCAAGC
TATGGCTCTCGAGATAAAACACCAGGGGCGGCGCCGCCTCGACGGCGGGAGACGCCCGTGCCTGACACGCCAAGC
ACGAGCAACGCGTCGGTTGAAATCTTCAAGTCGTTTCGCGTCAGCATGGACGACCCTTGCTACAAGGTGCTGCCG
GCAGCGCTCAAGAAGTATCAGATCAATGCGCCGTGGGACCAATACGCCCTATACATTGTCTACGGAGATCAAGAG
CGGTGTTTGGGCATGGACGAGAAGCCTCTTATCCTGTTTAAACAGCTCGACAAGGAAGGGAAAAAGCCCATGTTT
ATGCTACGTAAAACGAATAACGCTCCCGTGGACAGTGATCCTGGAAGTGCGGGAATGGGAGGCGCTGCCAGGGGA
CAAGCAACGGGGTACGATCCGCCAGGAGGCATCATATAA
Transcript >OphauB2|1911
ATGGGCTTCGACGGCGGCACAGCCTACGCCGAGTCGGACGCCGATGACGAGTATGAACGCAGCATCGGCGACCGT
TCTCCAGTTGGCGACTCGGAAGCATCGCCCATTGAGTCGGAGCCGCCGGCCTCGGCCGAGCACACGCCCACGACG
TACGGCCAACGCAGCGCGGCAGACCGGCTGCCAGAGACAGTCATTAGTGACTGGACAACGGACGAGTGTGCCGAC
TTTATTGGCACCATCGGCTTGCCGCAGTACGCCGATCGTTTTGTCGACAATGAAATCGTGGGCGAGGCCCTGGTG
GCGCTGCTGCACGACGACCTCAAGACCATGGGGATTGCCAGTGTCGGCCACCGCCTGACCATCCTCAAGAGCGTC
TACGATGTCAAGAGGGCCCAAGATGTGCCGATTGAGAGCGATCACTACTATCCCTTGTCTGCCGATGCTGAGGCT
CAGTATGCCACTGCTACGCTCAAGGACATTAAGCATCTGGTTGAGCAGCTGCGACTGCGAGACGAGCGAATGAGC
TTGCTGGAGCAAGACGTACGGCGCATGAATGATGATTTTCGGCGTCTAAGAGAAGACATGCTGCCGGCGCTGCGC
CTGGCCAAGGACGCCCAGCAGCCCTTGCCCAATGTCAGCAATAGCACGCAAGCCTACAGCCACGAGCCGACAGTC
TCGCCGCCTGCTCCAACACCAAACCCAGGCCAGGGCCCCGGTGCTGGCATGATGCGCTCCTTTTCTCAGAGAAAA
ATATTGATTGGTGCAACTCCCAAGGGTACCTCGCCGACGCAGCCGACACACGAAAGAACGATAGCAGAGCAAACG
CTAGATGCAGCCAGTGCAGCGGAGCGAGCTGCCATGGCTCCGTCGCACTTGACTGCCTTGAACGGCAGCGGACAG
ATTTCATCGTCATACCCCTCGCCCAACAATCCTTCACCAACCTCACCTCAAACCCATTTGGGCGGAGCAACGCTG
GCATCGAGATCGTACCGAGGCGAGTCATCAACAACATCTAGCAGGGCAAACCTCAATGATGCAGACTATGCAAGC
TATGGCTCTCGAGATAAAACACCAGGGGCGGCGCCGCCTCGACGGCGGGAGACGCCCGTGCCTGACACGCCAAGC
ACGAGCAACGCGTCGGTTGAAATCTTCAAGTCGTTTCGCGTCAGCATGGACGACCCTTGCTACAAGGTGCTGCCG
GCAGCGCTCAAGAAGTATCAGATCAATGCGCCGTGGGACCAATACGCCCTATACATTGTCTACGGAGATCAAGAG
CGGTGTTTGGGCATGGACGAGAAGCCTCTTATCCTGTTTAAACAGCTCGACAAGGAAGGGAAAAAGCCCATGTTT
ATGCTACGTAAAACGAATAACGCTCCCGTGGACAGTGATCCTGGAAGTGCGGGAATGGGAGGCGCTGCCAGGGGA
CAAGCAACGGGGTACGATCCGCCAGGAGGCATCATATAA
Gene >OphauB2|1911
ATGGGCTTCGACGGCGGCACAGCCTACGCCGAGTCGGACGCCGATGACGAGTATGAACGCAGCATCGGCGACCGT
TCTCCAGTTGGCGACTCGGAAGCATCGCCCATTGAGTCGGAGCCGCCGGCCTCGGCCGAGCACACGCCCACGACG
TACGGCCAACGCAGCGCGGCAGACCGGCTGCCAGAGACAGTCATTAGTGACTGGACAACGGACGAGTGTGCCGAC
TTTATTGGCACCATCGGCTTGCCGCAGTACGCCGATCGTTTTGTCGGTGTGTGCCGAGACGTGCTTCATGACTGC
GGCGGCCAGATGCATGAGGCCCAGCCCGCCAGTGGGCGTATGTTTGCTGACGTGGCCTTGTGCGTATGCAGACAA
TGAAATCGTGGGCGAGGCCCTGGTGGCGCTGCTGCACGACGACCTCAAGACCATGGGGATTGCCAGTGTCGGCCA
CCGCCTGACCATCCTCAAGAGCGTCTACGATGTCAAGAGGGCCCAAGATGTGCCGATTGAGAGCGATCACTACTA
TCCCTTGTGTAAGCGATGCTTGTCAAGCTTGAATGCAGACCACGTCTGACGAGGCTGCAGCTGCCGATGCTGAGG
CTCAGTATGCCACTGCTACGCTCAAGGACATTAAGCATCTGGTTGAGCAGCTGCGACTGCGAGACGAGCGAATGA
GCTTGCTGGAGCAAGACGTACGGCGCATGAATGATGATTTTCGGCGTCTAAGAGAAGACATGCTGCCGGCGCTGC
GCCTGGCCAAGGACGCCCAGCAGCCCTTGCCCAATGTCAGCAATAGCACGCAAGCCTACAGCCACGAGCCGACAG
TCTCGCCGCCTGCTCCAACACCAAACCCAGGCCAGGGCCCCGGTGCTGGCATGATGCGCTCCTTTTCTCAGAGAA
AAATATTGATTGGTGCAACTCCCAAGGGTACCTCGCCGACGCAGCCGACACACGAAAGAACGATAGCAGAGCAAA
CGCTAGATGCAGCCAGTGCAGCGGAGCGAGCTGCCATGGCTCCGTCGCACTTGACTGCCTTGAACGGCAGCGGAC
AGATTTCATCGTCATACCCCTCGCCCAACAATCCTTCACCAACCTCACCTCAAACCCATTTGGGCGGAGCAACGC
TGGCATCGAGATCGTACCGAGGCGAGTCATCAACAACATCTAGCAGGGCAAACCTCAATGATGCAGACTATGCAA
GCTATGGCTCTCGAGATAAAACACCAGGGGCGGCGCCGCCTCGACGGCGGGAGACGCCCGTGCCTGACACGCCAA
GCACGAGCAACGCGTCGGTTGAAATCTTCAAGTCGTTTCGCGTCAGCATGGACGACCCTTGCTACAAGGTGCTGC
CGGCAGCGCTCAAGAAGTATCAGATCAATGCGCCGTGGGACCAATACGCCCTATACATTGTCTACGGAGATCAAG
AGCGGTGTTTGGGCATGGACGAGAAGCCTCTTATCCTGTTTAAACAGCTCGACAAGGAAGGGAAAAAGCCCATGT
TTATGCTACGTAAAACGAATAACGCTCCCGTGGACAGTGATCCTGGAAGTGCGGGAATGGGAGGCGCTGCCAGGG
GACAAGCAACGGGGTACGATCCGCCAGGAGGCATCATATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail