Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1900
Gene name
LocationContig_155:34558..35986
Strand-
Gene length (bp)1428
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04088 Peroxin-13_N Peroxin 13, N-terminal region 2.7E-49 153 289
PF07653 SH3_2 Variant SH3 domain 4.8E-08 321 384
PF00018 SH3_1 SH3 domain 4.3E-07 325 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80667|PEX13_YEAST Peroxisomal membrane protein PAS20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX13 PE=1 SV=1 158 387 3.0E-60
sp|Q92266|PEX13_PICPA Peroxisomal membrane protein PEX13 OS=Komagataella pastoris GN=PEX13 PE=1 SV=1 160 387 9.0E-52
sp|O14136|PEX13_SCHPO Peroxisomal membrane protein pex13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex13 PE=3 SV=1 154 387 2.0E-34
sp|Q92968|PEX13_HUMAN Peroxisomal membrane protein PEX13 OS=Homo sapiens GN=PEX13 PE=1 SV=2 117 411 1.0E-15
sp|Q9D0K1|PEX13_MOUSE Peroxisomal membrane protein PEX13 OS=Mus musculus GN=Pex13 PE=1 SV=1 117 395 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80667|PEX13_YEAST Peroxisomal membrane protein PAS20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX13 PE=1 SV=1 158 387 3.0E-60
sp|Q92266|PEX13_PICPA Peroxisomal membrane protein PEX13 OS=Komagataella pastoris GN=PEX13 PE=1 SV=1 160 387 9.0E-52
sp|O14136|PEX13_SCHPO Peroxisomal membrane protein pex13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex13 PE=3 SV=1 154 387 2.0E-34
sp|Q92968|PEX13_HUMAN Peroxisomal membrane protein PEX13 OS=Homo sapiens GN=PEX13 PE=1 SV=2 117 411 1.0E-15
sp|Q9D0K1|PEX13_MOUSE Peroxisomal membrane protein PEX13 OS=Mus musculus GN=Pex13 PE=1 SV=1 117 395 2.0E-14
sp|Q0P5B1|PEX13_BOVIN Peroxisomal membrane protein PEX13 OS=Bos taurus GN=PEX13 PE=2 SV=1 117 404 3.0E-14
sp|Q19951|PEX13_CAEEL Probable peroxisomal membrane protein PEX13 OS=Caenorhabditis elegans GN=prx-13 PE=3 SV=2 165 301 8.0E-12
sp|P47941|CRKL_MOUSE Crk-like protein OS=Mus musculus GN=Crkl PE=1 SV=2 313 391 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016560 protein import into peroxisome matrix, docking Yes
GO:0016021 integral component of membrane Yes
GO:0005777 peroxisome Yes
GO:0005515 protein binding Yes
GO:0051641 cellular localization No
GO:0043229 intracellular organelle No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0033036 macromolecule localization No
GO:0031224 intrinsic component of membrane No
GO:0042579 microbody No
GO:0051179 localization No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1900
MASPPKPWERAGAASAAMPSAAAPSAASTTPTAASPSSSASSSSSSAAPPLPDRPSSLASSVNQNAAAYSRMGVG
ASPYSSYGAGAYSSPYGSPYSSPYSRMSGMGGYGGMGGMYGGYGGYGGGMYGGGMYGGMGGMGGMGGMPGNPNDP
NSLTNRFNNGTAATFQMLEGIVTAFAGFAQMLESTYMATHSSFFAMVSVAEQFGNLRDTLGSILGIFTLMRWIRT
LIAKITGRPPPADAMALTPAAFAHFEGRSTGPDGTPGPPRASRKPLFFFLAAAFGLPYLMSKMIRTMAASHEEEE
RRLQQQALEAQQPVDPSKLEFCRLLYDFMPQPTSASAGMELQARKGDLVAVLSKLDPAGNASEWWQCRSRDGRQG
YLPSTYLEVLKRPAHHDVKAIKGTSASDSSRASSLTSAIERPEEGKKEYASADGMQRSHFYS*
Coding >OphauB2|1900
ATGGCCTCGCCTCCCAAGCCTTGGGAGAGAGCCGGCGCTGCGTCGGCTGCCATGCCATCTGCTGCCGCTCCCTCG
GCCGCATCCACAACACCAACAGCCGCATCGCCATCATCGTCAGCTTCTTCTTCCTCGTCTTCAGCTGCTCCTCCC
CTCCCTGATCGCCCTTCATCTCTCGCCTCGTCGGTTAATCAAAATGCTGCTGCCTATAGCCGCATGGGCGTAGGC
GCTTCACCCTACAGCTCCTATGGTGCCGGTGCCTACTCATCCCCATACGGCAGTCCCTACTCAAGTCCATATTCG
CGAATGAGCGGCATGGGCGGCTACGGAGGCATGGGAGGCATGTACGGTGGTTATGGCGGCTACGGGGGCGGCATG
TATGGAGGCGGCATGTACGGCGGCATGGGCGGCATGGGCGGCATGGGCGGCATGCCCGGGAATCCCAATGACCCC
AATAGTCTCACCAACCGCTTCAACAATGGCACCGCGGCCACGTTTCAGATGCTCGAGGGCATCGTGACCGCCTTT
GCCGGCTTCGCCCAGATGCTCGAGAGCACTTATATGGCGACACATTCTAGCTTCTTTGCCATGGTGTCTGTGGCG
GAACAGTTTGGAAACCTGCGAGACACACTTGGCTCCATCCTCGGCATCTTTACTCTTATGCGCTGGATCCGTACC
CTAATTGCCAAAATCACCGGCCGCCCACCCCCTGCCGATGCAATGGCCTTGACTCCCGCTGCATTTGCACACTTT
GAGGGGCGTTCAACTGGCCCAGACGGCACTCCAGGACCCCCTCGAGCCAGCCGAAAACCCCTATTCTTCTTCCTC
GCCGCCGCCTTTGGCCTCCCCTATCTCATGTCCAAGATGATTCGCACCATGGCCGCCTCGCACGAGGAGGAAGAG
CGGCGCCTCCAGCAACAGGCTCTGGAGGCGCAGCAGCCCGTCGATCCGTCCAAGCTCGAGTTTTGTCGCCTGCTA
TACGACTTTATGCCCCAGCCCACGAGCGCCAGCGCCGGCATGGAATTGCAGGCGCGCAAAGGCGACCTTGTTGCT
GTCTTGAGCAAACTCGACCCAGCCGGCAACGCCAGCGAATGGTGGCAGTGCCGGTCGCGCGACGGTCGCCAGGGC
TACTTGCCGTCAACCTATCTCGAGGTGCTCAAACGGCCCGCCCACCACGACGTCAAGGCCATCAAGGGGACTTCA
GCCAGCGACAGCAGCCGGGCTAGTTCTCTAACGAGTGCCATTGAGCGCCCCGAAGAAGGCAAGAAGGAATATGCG
TCGGCCGACGGCATGCAAAGAAGCCACTTTTACTCGTGA
Transcript >OphauB2|1900
ATGGCCTCGCCTCCCAAGCCTTGGGAGAGAGCCGGCGCTGCGTCGGCTGCCATGCCATCTGCTGCCGCTCCCTCG
GCCGCATCCACAACACCAACAGCCGCATCGCCATCATCGTCAGCTTCTTCTTCCTCGTCTTCAGCTGCTCCTCCC
CTCCCTGATCGCCCTTCATCTCTCGCCTCGTCGGTTAATCAAAATGCTGCTGCCTATAGCCGCATGGGCGTAGGC
GCTTCACCCTACAGCTCCTATGGTGCCGGTGCCTACTCATCCCCATACGGCAGTCCCTACTCAAGTCCATATTCG
CGAATGAGCGGCATGGGCGGCTACGGAGGCATGGGAGGCATGTACGGTGGTTATGGCGGCTACGGGGGCGGCATG
TATGGAGGCGGCATGTACGGCGGCATGGGCGGCATGGGCGGCATGGGCGGCATGCCCGGGAATCCCAATGACCCC
AATAGTCTCACCAACCGCTTCAACAATGGCACCGCGGCCACGTTTCAGATGCTCGAGGGCATCGTGACCGCCTTT
GCCGGCTTCGCCCAGATGCTCGAGAGCACTTATATGGCGACACATTCTAGCTTCTTTGCCATGGTGTCTGTGGCG
GAACAGTTTGGAAACCTGCGAGACACACTTGGCTCCATCCTCGGCATCTTTACTCTTATGCGCTGGATCCGTACC
CTAATTGCCAAAATCACCGGCCGCCCACCCCCTGCCGATGCAATGGCCTTGACTCCCGCTGCATTTGCACACTTT
GAGGGGCGTTCAACTGGCCCAGACGGCACTCCAGGACCCCCTCGAGCCAGCCGAAAACCCCTATTCTTCTTCCTC
GCCGCCGCCTTTGGCCTCCCCTATCTCATGTCCAAGATGATTCGCACCATGGCCGCCTCGCACGAGGAGGAAGAG
CGGCGCCTCCAGCAACAGGCTCTGGAGGCGCAGCAGCCCGTCGATCCGTCCAAGCTCGAGTTTTGTCGCCTGCTA
TACGACTTTATGCCCCAGCCCACGAGCGCCAGCGCCGGCATGGAATTGCAGGCGCGCAAAGGCGACCTTGTTGCT
GTCTTGAGCAAACTCGACCCAGCCGGCAACGCCAGCGAATGGTGGCAGTGCCGGTCGCGCGACGGTCGCCAGGGC
TACTTGCCGTCAACCTATCTCGAGGTGCTCAAACGGCCCGCCCACCACGACGTCAAGGCCATCAAGGGGACTTCA
GCCAGCGACAGCAGCCGGGCTAGTTCTCTAACGAGTGCCATTGAGCGCCCCGAAGAAGGCAAGAAGGAATATGCG
TCGGCCGACGGCATGCAAAGAAGCCACTTTTACTCGTGA
Gene >OphauB2|1900
ATGGCCTCGCCTCCCAAGCCTTGGGAGAGAGCCGGCGCTGCGTCGGGTAAGTCGCTGCATCACATGCTTCATTTC
TGCTCCAGACTTAATGCGGCACAGCTGCCATGCCATCTGCTGCCGCTCCCTCGGCCGCATCCACAACACCAACAG
CCGCATCGCCATCATCGTCAGCTTCTTCTTCCTCGTCTTCAGCTGCTCCTCCCCTCCCTGATCGCCCTTCATCTC
TCGCCTCGTCGGTTAATCAAAATGCTGCTGCCTATAGCCGCATGGGCGTAGGCGCTTCACCCTACAGCTCCTATG
GTGCCGGTGCCTACTCATCCCCATACGGCAGTCCCTACTCAAGTCCATATTCGCGAATGAGCGGCATGGGCGGCT
ACGGAGGCATGGGAGGCATGTACGGTGGTTATGGCGGCTACGGGGGCGGCATGTATGGAGGCGGCATGTACGGCG
GCATGGGCGGCATGGGCGGCATGGGCGGCATGCCCGGGAATCCCAATGACCCCAATAGTCTCACCAACCGCTTCA
ACAATGGCACCGCGGCCACGTTTCAGATGCTCGAGGGCATCGTGACCGCCTTTGCCGGCTTCGCCCAGATGCTCG
AGAGCACTTATATGGCGACACATTCTAGCTTCTTTGGTATGCCCTTGGTCTACGTGTGAGACGACGCCTCTTGAT
ATGCTGACGGGGCAAACAATAGCCATGGTGTCTGTGGCGGAACAGTTTGGAAACCTGCGAGACACACTTGGCTCC
ATCCTCGGCATCTTTACTCTTATGCGCTGGATCCGTACCCTAATTGCCAAAATCACCGGCCGCCCACCCCCTGCC
GATGCAATGGCCTTGACTCCCGCTGCATTTGCACACTTTGAGGGGCGTTCAACTGGCCCAGACGGCACTCCAGGA
CCCCCTCGAGCCAGCCGAAAACCCCTATTCTTCTTCCTCGCCGCCGCCTTTGGCCTCCCCTATCTCATGTCCAAG
ATGATTCGCACCATGGCCGCCTCGCACGAGGAGGAAGAGCGGCGCCTCCAGCAACAGGCTCTGGAGGCGCAGCAG
CCCGTCGATCCGTCCAAGCTCGAGTTTTGTCGCCTGCTATACGACTTTATGCCCCAGCCCACGAGCGCCAGCGCC
GGCATGGAATTGCAGGCGCGCAAAGGCGACCTTGTTGCTGTCTTGAGCAAACTCGACCCAGCCGGCAACGCCAGC
GAATGGTGGCAGTGCCGGTCGCGCGACGGTCGCCAGGGCTACTTGCCGTCAACCTATCTCGAGGTGCTCAAACGG
CCCGCCCACCACGACGTCAAGGCCATCAAGGGGACTTCAGCCAGCGACAGCAGCCGGGCTAGTTCTCTAACGAGT
GCCATTGAGCGCCCCGAAGAAGGCAAGAAGGAATATGCGTCGGCCGACGGCATGCAAAGAAGCCACTTTTACTCG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail