Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1900
Gene name
LocationContig_155:34558..35986
Strand-
Gene length (bp)1428
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04088 Peroxin-13_N Peroxin 13, N-terminal region 2.7E-49 153 289
PF07653 SH3_2 Variant SH3 domain 4.8E-08 321 384
PF00018 SH3_1 SH3 domain 4.3E-07 325 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80667|PEX13_YEAST Peroxisomal membrane protein PAS20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX13 PE=1 SV=1 158 387 3.0E-60
sp|Q92266|PEX13_PICPA Peroxisomal membrane protein PEX13 OS=Komagataella pastoris GN=PEX13 PE=1 SV=1 160 387 9.0E-52
sp|O14136|PEX13_SCHPO Peroxisomal membrane protein pex13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex13 PE=3 SV=1 154 387 2.0E-34
sp|Q92968|PEX13_HUMAN Peroxisomal membrane protein PEX13 OS=Homo sapiens GN=PEX13 PE=1 SV=2 117 411 1.0E-15
sp|Q9D0K1|PEX13_MOUSE Peroxisomal membrane protein PEX13 OS=Mus musculus GN=Pex13 PE=1 SV=1 117 395 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80667|PEX13_YEAST Peroxisomal membrane protein PAS20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX13 PE=1 SV=1 158 387 3.0E-60
sp|Q92266|PEX13_PICPA Peroxisomal membrane protein PEX13 OS=Komagataella pastoris GN=PEX13 PE=1 SV=1 160 387 9.0E-52
sp|O14136|PEX13_SCHPO Peroxisomal membrane protein pex13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex13 PE=3 SV=1 154 387 2.0E-34
sp|Q92968|PEX13_HUMAN Peroxisomal membrane protein PEX13 OS=Homo sapiens GN=PEX13 PE=1 SV=2 117 411 1.0E-15
sp|Q9D0K1|PEX13_MOUSE Peroxisomal membrane protein PEX13 OS=Mus musculus GN=Pex13 PE=1 SV=1 117 395 2.0E-14
sp|Q0P5B1|PEX13_BOVIN Peroxisomal membrane protein PEX13 OS=Bos taurus GN=PEX13 PE=2 SV=1 117 404 3.0E-14
sp|Q19951|PEX13_CAEEL Probable peroxisomal membrane protein PEX13 OS=Caenorhabditis elegans GN=prx-13 PE=3 SV=2 165 301 8.0E-12
sp|P47941|CRKL_MOUSE Crk-like protein OS=Mus musculus GN=Crkl PE=1 SV=2 313 391 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016560 protein import into peroxisome matrix, docking Yes
GO:0016021 integral component of membrane Yes
GO:0005777 peroxisome Yes
GO:0005515 protein binding Yes
GO:0051641 cellular localization No
GO:0043229 intracellular organelle No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0033036 macromolecule localization No
GO:0031224 intrinsic component of membrane No
GO:0042579 microbody No
GO:0051179 localization No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008104 protein localization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4138
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6367
Ophiocordyceps australis map64 (Brazil) OphauB2|1900 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02303
Ophiocordyceps camponoti-rufipedis Ophun1|3628
Ophiocordyceps kimflemingae Ophio5|7884
Ophiocordyceps subramaniannii Hirsu2|8389

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1900
MASPPKPWERAGAASAAMPSAAAPSAASTTPTAASPSSSASSSSSSAAPPLPDRPSSLASSVNQNAAAYSRMGVG
ASPYSSYGAGAYSSPYGSPYSSPYSRMSGMGGYGGMGGMYGGYGGYGGGMYGGGMYGGMGGMGGMGGMPGNPNDP
NSLTNRFNNGTAATFQMLEGIVTAFAGFAQMLESTYMATHSSFFAMVSVAEQFGNLRDTLGSILGIFTLMRWIRT
LIAKITGRPPPADAMALTPAAFAHFEGRSTGPDGTPGPPRASRKPLFFFLAAAFGLPYLMSKMIRTMAASHEEEE
RRLQQQALEAQQPVDPSKLEFCRLLYDFMPQPTSASAGMELQARKGDLVAVLSKLDPAGNASEWWQCRSRDGRQG
YLPSTYLEVLKRPAHHDVKAIKGTSASDSSRASSLTSAIERPEEGKKEYASADGMQRSHFYS*
Coding >OphauB2|1900
ATGGCCTCGCCTCCCAAGCCTTGGGAGAGAGCCGGCGCTGCGTCGGCTGCCATGCCATCTGCTGCCGCTCCCTCG
GCCGCATCCACAACACCAACAGCCGCATCGCCATCATCGTCAGCTTCTTCTTCCTCGTCTTCAGCTGCTCCTCCC
CTCCCTGATCGCCCTTCATCTCTCGCCTCGTCGGTTAATCAAAATGCTGCTGCCTATAGCCGCATGGGCGTAGGC
GCTTCACCCTACAGCTCCTATGGTGCCGGTGCCTACTCATCCCCATACGGCAGTCCCTACTCAAGTCCATATTCG
CGAATGAGCGGCATGGGCGGCTACGGAGGCATGGGAGGCATGTACGGTGGTTATGGCGGCTACGGGGGCGGCATG
TATGGAGGCGGCATGTACGGCGGCATGGGCGGCATGGGCGGCATGGGCGGCATGCCCGGGAATCCCAATGACCCC
AATAGTCTCACCAACCGCTTCAACAATGGCACCGCGGCCACGTTTCAGATGCTCGAGGGCATCGTGACCGCCTTT
GCCGGCTTCGCCCAGATGCTCGAGAGCACTTATATGGCGACACATTCTAGCTTCTTTGCCATGGTGTCTGTGGCG
GAACAGTTTGGAAACCTGCGAGACACACTTGGCTCCATCCTCGGCATCTTTACTCTTATGCGCTGGATCCGTACC
CTAATTGCCAAAATCACCGGCCGCCCACCCCCTGCCGATGCAATGGCCTTGACTCCCGCTGCATTTGCACACTTT
GAGGGGCGTTCAACTGGCCCAGACGGCACTCCAGGACCCCCTCGAGCCAGCCGAAAACCCCTATTCTTCTTCCTC
GCCGCCGCCTTTGGCCTCCCCTATCTCATGTCCAAGATGATTCGCACCATGGCCGCCTCGCACGAGGAGGAAGAG
CGGCGCCTCCAGCAACAGGCTCTGGAGGCGCAGCAGCCCGTCGATCCGTCCAAGCTCGAGTTTTGTCGCCTGCTA
TACGACTTTATGCCCCAGCCCACGAGCGCCAGCGCCGGCATGGAATTGCAGGCGCGCAAAGGCGACCTTGTTGCT
GTCTTGAGCAAACTCGACCCAGCCGGCAACGCCAGCGAATGGTGGCAGTGCCGGTCGCGCGACGGTCGCCAGGGC
TACTTGCCGTCAACCTATCTCGAGGTGCTCAAACGGCCCGCCCACCACGACGTCAAGGCCATCAAGGGGACTTCA
GCCAGCGACAGCAGCCGGGCTAGTTCTCTAACGAGTGCCATTGAGCGCCCCGAAGAAGGCAAGAAGGAATATGCG
TCGGCCGACGGCATGCAAAGAAGCCACTTTTACTCGTGA
Transcript >OphauB2|1900
ATGGCCTCGCCTCCCAAGCCTTGGGAGAGAGCCGGCGCTGCGTCGGCTGCCATGCCATCTGCTGCCGCTCCCTCG
GCCGCATCCACAACACCAACAGCCGCATCGCCATCATCGTCAGCTTCTTCTTCCTCGTCTTCAGCTGCTCCTCCC
CTCCCTGATCGCCCTTCATCTCTCGCCTCGTCGGTTAATCAAAATGCTGCTGCCTATAGCCGCATGGGCGTAGGC
GCTTCACCCTACAGCTCCTATGGTGCCGGTGCCTACTCATCCCCATACGGCAGTCCCTACTCAAGTCCATATTCG
CGAATGAGCGGCATGGGCGGCTACGGAGGCATGGGAGGCATGTACGGTGGTTATGGCGGCTACGGGGGCGGCATG
TATGGAGGCGGCATGTACGGCGGCATGGGCGGCATGGGCGGCATGGGCGGCATGCCCGGGAATCCCAATGACCCC
AATAGTCTCACCAACCGCTTCAACAATGGCACCGCGGCCACGTTTCAGATGCTCGAGGGCATCGTGACCGCCTTT
GCCGGCTTCGCCCAGATGCTCGAGAGCACTTATATGGCGACACATTCTAGCTTCTTTGCCATGGTGTCTGTGGCG
GAACAGTTTGGAAACCTGCGAGACACACTTGGCTCCATCCTCGGCATCTTTACTCTTATGCGCTGGATCCGTACC
CTAATTGCCAAAATCACCGGCCGCCCACCCCCTGCCGATGCAATGGCCTTGACTCCCGCTGCATTTGCACACTTT
GAGGGGCGTTCAACTGGCCCAGACGGCACTCCAGGACCCCCTCGAGCCAGCCGAAAACCCCTATTCTTCTTCCTC
GCCGCCGCCTTTGGCCTCCCCTATCTCATGTCCAAGATGATTCGCACCATGGCCGCCTCGCACGAGGAGGAAGAG
CGGCGCCTCCAGCAACAGGCTCTGGAGGCGCAGCAGCCCGTCGATCCGTCCAAGCTCGAGTTTTGTCGCCTGCTA
TACGACTTTATGCCCCAGCCCACGAGCGCCAGCGCCGGCATGGAATTGCAGGCGCGCAAAGGCGACCTTGTTGCT
GTCTTGAGCAAACTCGACCCAGCCGGCAACGCCAGCGAATGGTGGCAGTGCCGGTCGCGCGACGGTCGCCAGGGC
TACTTGCCGTCAACCTATCTCGAGGTGCTCAAACGGCCCGCCCACCACGACGTCAAGGCCATCAAGGGGACTTCA
GCCAGCGACAGCAGCCGGGCTAGTTCTCTAACGAGTGCCATTGAGCGCCCCGAAGAAGGCAAGAAGGAATATGCG
TCGGCCGACGGCATGCAAAGAAGCCACTTTTACTCGTGA
Gene >OphauB2|1900
ATGGCCTCGCCTCCCAAGCCTTGGGAGAGAGCCGGCGCTGCGTCGGGTAAGTCGCTGCATCACATGCTTCATTTC
TGCTCCAGACTTAATGCGGCACAGCTGCCATGCCATCTGCTGCCGCTCCCTCGGCCGCATCCACAACACCAACAG
CCGCATCGCCATCATCGTCAGCTTCTTCTTCCTCGTCTTCAGCTGCTCCTCCCCTCCCTGATCGCCCTTCATCTC
TCGCCTCGTCGGTTAATCAAAATGCTGCTGCCTATAGCCGCATGGGCGTAGGCGCTTCACCCTACAGCTCCTATG
GTGCCGGTGCCTACTCATCCCCATACGGCAGTCCCTACTCAAGTCCATATTCGCGAATGAGCGGCATGGGCGGCT
ACGGAGGCATGGGAGGCATGTACGGTGGTTATGGCGGCTACGGGGGCGGCATGTATGGAGGCGGCATGTACGGCG
GCATGGGCGGCATGGGCGGCATGGGCGGCATGCCCGGGAATCCCAATGACCCCAATAGTCTCACCAACCGCTTCA
ACAATGGCACCGCGGCCACGTTTCAGATGCTCGAGGGCATCGTGACCGCCTTTGCCGGCTTCGCCCAGATGCTCG
AGAGCACTTATATGGCGACACATTCTAGCTTCTTTGGTATGCCCTTGGTCTACGTGTGAGACGACGCCTCTTGAT
ATGCTGACGGGGCAAACAATAGCCATGGTGTCTGTGGCGGAACAGTTTGGAAACCTGCGAGACACACTTGGCTCC
ATCCTCGGCATCTTTACTCTTATGCGCTGGATCCGTACCCTAATTGCCAAAATCACCGGCCGCCCACCCCCTGCC
GATGCAATGGCCTTGACTCCCGCTGCATTTGCACACTTTGAGGGGCGTTCAACTGGCCCAGACGGCACTCCAGGA
CCCCCTCGAGCCAGCCGAAAACCCCTATTCTTCTTCCTCGCCGCCGCCTTTGGCCTCCCCTATCTCATGTCCAAG
ATGATTCGCACCATGGCCGCCTCGCACGAGGAGGAAGAGCGGCGCCTCCAGCAACAGGCTCTGGAGGCGCAGCAG
CCCGTCGATCCGTCCAAGCTCGAGTTTTGTCGCCTGCTATACGACTTTATGCCCCAGCCCACGAGCGCCAGCGCC
GGCATGGAATTGCAGGCGCGCAAAGGCGACCTTGTTGCTGTCTTGAGCAAACTCGACCCAGCCGGCAACGCCAGC
GAATGGTGGCAGTGCCGGTCGCGCGACGGTCGCCAGGGCTACTTGCCGTCAACCTATCTCGAGGTGCTCAAACGG
CCCGCCCACCACGACGTCAAGGCCATCAAGGGGACTTCAGCCAGCGACAGCAGCCGGGCTAGTTCTCTAACGAGT
GCCATTGAGCGCCCCGAAGAAGGCAAGAAGGAATATGCGTCGGCCGACGGCATGCAAAGAAGCCACTTTTACTCG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail