Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1897
Gene name
LocationContig_155:28052..28825
Strand+
Gene length (bp)773
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04588 HIG_1_N Hypoxia induced protein conserved region 1.5E-05 135 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P3B2|RCF2_SCHPO Respiratory supercomplex factor 2 homolog C1565.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rcf2 PE=3 SV=1 1 222 1.0E-24
sp|P53721|RCF2_YEAST Respiratory supercomplex factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCF2 PE=1 SV=1 1 182 1.0E-20

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 116 135 19
3 145 167 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1412
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6364
Ophiocordyceps australis map64 (Brazil) OphauB2|1897 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02301
Ophiocordyceps camponoti-rufipedis Ophun1|3630
Ophiocordyceps kimflemingae Ophio5|7881
Ophiocordyceps subramaniannii Hirsu2|10903

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1897
MKVLSKEEEEAHYSAVLRGGLIGGSAGLALGLGGVLFASRRYPAFRSLTLPFRTFLVTSTATFGAIVNADRYSVK
FQRAQHPESGYRDQSALAMDRVHKAEGPWRRFLDWGRENRYPIVFASWLASMGVSMAIVGRAPISTAQKLVQARV
YAQALTLAVLIITACFEMNDAKTGSGRWETVLVLDPNDPEHKHLIEKKIHKEEYEGQDLWMDMVEAEERRMQDKK
ASQTKTS*
Coding >OphauB2|1897
ATGAAGGTGCTCAGCAAGGAAGAAGAAGAGGCGCATTACTCGGCCGTGCTTCGAGGTGGCCTCATTGGCGGCAGC
GCCGGTCTCGCCCTCGGGCTGGGCGGCGTCTTGTTCGCCTCTCGTCGTTATCCAGCCTTTCGCAGCCTGACGCTC
CCCTTTCGCACCTTTCTCGTCACGTCTACGGCAACCTTTGGCGCCATTGTCAATGCAGACCGCTACAGCGTCAAG
TTTCAGCGCGCCCAGCATCCCGAGTCTGGCTACCGCGACCAGAGCGCTCTGGCCATGGACCGTGTCCACAAGGCT
GAGGGTCCCTGGCGCCGCTTTCTCGATTGGGGCCGCGAGAACCGCTATCCAATTGTCTTTGCCTCGTGGCTTGCC
AGCATGGGCGTCTCCATGGCCATTGTCGGCCGCGCTCCCATAAGCACCGCCCAGAAGCTTGTCCAGGCTCGTGTT
TATGCCCAGGCCCTTACGCTTGCCGTTCTCATCATTACCGCTTGTTTTGAGATGAATGACGCCAAAACCGGCAGC
GGCCGCTGGGAGACGGTCCTGGTGCTTGACCCCAACGATCCCGAGCACAAGCACCTCATCGAGAAGAAGATTCAC
AAGGAGGAATATGAAGGCCAAGACTTGTGGATGGACATGGTCGAGGCTGAGGAACGCCGCATGCAGGACAAAAAG
GCTTCCCAAACCAAGACGTCATGA
Transcript >OphauB2|1897
ATGAAGGTGCTCAGCAAGGAAGAAGAAGAGGCGCATTACTCGGCCGTGCTTCGAGGTGGCCTCATTGGCGGCAGC
GCCGGTCTCGCCCTCGGGCTGGGCGGCGTCTTGTTCGCCTCTCGTCGTTATCCAGCCTTTCGCAGCCTGACGCTC
CCCTTTCGCACCTTTCTCGTCACGTCTACGGCAACCTTTGGCGCCATTGTCAATGCAGACCGCTACAGCGTCAAG
TTTCAGCGCGCCCAGCATCCCGAGTCTGGCTACCGCGACCAGAGCGCTCTGGCCATGGACCGTGTCCACAAGGCT
GAGGGTCCCTGGCGCCGCTTTCTCGATTGGGGCCGCGAGAACCGCTATCCAATTGTCTTTGCCTCGTGGCTTGCC
AGCATGGGCGTCTCCATGGCCATTGTCGGCCGCGCTCCCATAAGCACCGCCCAGAAGCTTGTCCAGGCTCGTGTT
TATGCCCAGGCCCTTACGCTTGCCGTTCTCATCATTACCGCTTGTTTTGAGATGAATGACGCCAAAACCGGCAGC
GGCCGCTGGGAGACGGTCCTGGTGCTTGACCCCAACGATCCCGAGCACAAGCACCTCATCGAGAAGAAGATTCAC
AAGGAGGAATATGAAGGCCAAGACTTGTGGATGGACATGGTCGAGGCTGAGGAACGCCGCATGCAGGACAAAAAG
GCTTCCCAAACCAAGACGTCATGA
Gene >OphauB2|1897
ATGAAGGTGCTCAGCAAGGAAGAAGAAGAGGCGCATTACTCGGCCGTGCTTCGAGGTGGCCTCATTGGCGGCAGC
GCCGGTCTCGCCCTCGGGCTGGGCGGCGTCTTGTTCGCCTCTCGTCGTTATCCAGCCTTTCGCAGCCTGACGCTC
CCCTTTCGCACCTTTCTCGTCACGTCTACGGCAACCTTTGGCGCCATTGTCAATGCAGACCGCTACAGCGTCAAG
TTTCAGCGCGCCCAGCATCCCGAGTCTGGCTACCGCGACCAGAGCGCTCTGGCCATGGACCGTGTCCACAAGGCT
GAGGGTCCCTGGCGCCGCTTTCTCGATTGGGGCCGCGAGAACCGCTATCCAATTGTCTTTGCCTCGTGGCTTGCC
AGCATGGGCGTCTCCATGGCCATTGTCGGCCGCGCTCCCATAAGCACCGCCCAGAAGCTTGTCCAGGCTCGTGTT
TATGCCCAGGCCCTTACGCTTGCCGTTCTCATCATTACCGCTTGTTTTGAGATGAATGACGCCAAAACCGGCAGC
GGCCGCTGGGAGACGGTCCTGGTGCTTGACCCCAACGATCCCGAGCACAAGCACCTCATCGAGAAGAAGATTCAC
AAGGAGGAATATGAAGGCCAAGACTTGTGGATGGGTAAGCGTCCCATCATGTCCATCTTCAATGACCCATTATTG
CACCGCTTGCGCTGACGCTGATGTGTGATCAAGACATGGTCGAGGCTGAGGAACGCCGCATGCAGGACAAAAAGG
CTTCCCAAACCAAGACGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail