Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1878
Gene name
LocationContig_154:19430..21250
Strand+
Gene length (bp)1820
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 1.3E-12 125 279
PF13649 Methyltransf_25 Methyltransferase domain 3.5E-09 365 454
PF13847 Methyltransf_31 Methyltransferase domain 2.3E-07 363 457
PF08241 Methyltransf_11 Methyltransferase domain 1.1E-05 366 440
PF02655 ATP-grasp_3 ATP-grasp domain 1.8E-05 104 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12EL3|DDL_POLSJ D-alanine--D-alanine ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ddl PE=3 SV=1 127 279 3.0E-07
sp|B1XT11|DDL_POLNS D-alanine--D-alanine ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ddl PE=3 SV=1 55 279 6.0E-07
sp|Q023Q5|DDL_SOLUE D-alanine--D-alanine ligase OS=Solibacter usitatus (strain Ellin6076) GN=ddl PE=3 SV=1 126 285 1.0E-06
sp|B3QMS4|DDL_CHLP8 D-alanine--D-alanine ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=ddl PE=3 SV=1 126 284 2.0E-06
sp|Q8PCJ8|DDLB_XANCP D-alanine--D-alanine ligase B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ddlB PE=3 SV=1 56 279 4.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12EL3|DDL_POLSJ D-alanine--D-alanine ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ddl PE=3 SV=1 127 279 3.0E-07
sp|B1XT11|DDL_POLNS D-alanine--D-alanine ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ddl PE=3 SV=1 55 279 6.0E-07
sp|Q023Q5|DDL_SOLUE D-alanine--D-alanine ligase OS=Solibacter usitatus (strain Ellin6076) GN=ddl PE=3 SV=1 126 285 1.0E-06
sp|B3QMS4|DDL_CHLP8 D-alanine--D-alanine ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=ddl PE=3 SV=1 126 284 2.0E-06
sp|Q8PCJ8|DDLB_XANCP D-alanine--D-alanine ligase B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ddlB PE=3 SV=1 56 279 4.0E-06
sp|A4SV76|DDL_POLSQ D-alanine--D-alanine ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ddl PE=3 SV=1 55 279 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0008168 methyltransferase activity Yes
GO:0046872 metal ion binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043169 cation binding No
GO:0017076 purine nucleotide binding No
GO:0003824 catalytic activity No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0016874 ligase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016881 acid-amino acid ligase activity No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1878
MKICLINSSYEGANSPFEAASYDPLPDPSRYIPEGRHEFVSKFVTKANAKAEIDEICKEKYDLFFNYMWGLESDN
VAGLDATLYLESKGIPILGQPSSFLSKTKLHLAKAAKLSGLRMPQNTPGKYPKIVKHATTCGSLGLDYDSVCHDE
AAVKRRIAHLQQVDDTPLLVSDYITGAECSAMVIETGRDVVALTPLKYVFPPGTPPEQAFLTWHNKFEACEDGTI
TYALVEGKEKASLQKAAVDAFKALKIKGGAWARVDMRLEDGTNDVYVLEVNSIPVVFYPRGNKLGDDLVVEETFP
GAHLAFMDMLLATKMMQLGLHKKQTKHLASVYDKFAPSYDGVWRAAGLRKVQELMVRKFDFGGTVLDLACGTGAV
GRVLHEAGIEAEITGIEVSEGMLQSSPDIHQHYKQPIIVGPMEEEIMTAGPHDHVVCFGALHFLQPVMFNAVLAK
MFMLARKSVSFDIDDVPPSYIDFLRDNHGQLFINYNHVEEMEQFGVPKAWKLVHKSHEFLFTSPHAGHDIFGYAL
RFERL*
Coding >OphauB2|1878
ATGAAAATTTGTCTCATAAACTCGTCCTATGAGGGCGCCAACTCGCCCTTTGAAGCGGCGAGTTATGACCCTCTG
CCGGATCCGAGTCGCTACATTCCCGAGGGGCGCCATGAGTTTGTGTCCAAGTTTGTCACAAAGGCCAATGCCAAG
GCTGAGATTGACGAGATTTGCAAGGAAAAGTATGACTTGTTTTTCAACTACATGTGGGGCCTCGAGTCGGACAAT
GTTGCCGGCCTCGACGCCACCCTCTACCTAGAGAGCAAGGGCATCCCCATTCTGGGCCAGCCGTCCAGCTTTCTA
TCCAAGACCAAGCTGCATCTTGCCAAGGCGGCCAAGCTATCGGGACTGCGCATGCCGCAAAATACGCCTGGCAAA
TACCCCAAAATCGTCAAACATGCCACGACTTGCGGCTCGCTTGGACTCGACTACGACTCCGTCTGCCACGACGAG
GCGGCTGTCAAGCGACGGATAGCCCATCTCCAGCAGGTCGACGACACTCCTCTCCTAGTTTCCGACTACATCACT
GGCGCCGAGTGCTCAGCCATGGTGATTGAGACGGGAAGAGACGTGGTGGCGCTGACGCCGCTCAAGTACGTCTTC
CCCCCGGGCACTCCACCAGAACAGGCCTTTTTGACGTGGCACAACAAATTCGAGGCCTGTGAGGATGGAACAATC
ACCTATGCTCTAGTCGAGGGCAAGGAAAAGGCCAGTCTGCAAAAGGCAGCCGTTGACGCCTTCAAGGCCCTCAAG
ATCAAGGGCGGGGCCTGGGCACGAGTCGACATGCGGCTTGAAGACGGCACAAACGACGTCTATGTGCTCGAGGTC
AACTCGATCCCCGTCGTCTTCTACCCCAGGGGGAACAAGCTGGGCGACGACTTGGTGGTGGAAGAAACCTTTCCC
GGCGCCCATCTGGCCTTTATGGATATGCTGCTGGCAACCAAGATGATGCAGCTGGGCCTGCACAAGAAGCAGACC
AAACACTTGGCCTCGGTCTATGACAAGTTTGCCCCTAGCTACGATGGAGTTTGGCGTGCTGCCGGCCTGCGCAAG
GTGCAGGAGTTGATGGTGCGTAAGTTTGATTTTGGCGGAACGGTGCTGGACCTGGCCTGTGGCACTGGGGCCGTT
GGCCGCGTCTTGCACGAGGCGGGCATCGAGGCCGAAATCACGGGTATTGAAGTCTCAGAGGGCATGCTGCAGTCG
TCGCCCGACATTCACCAGCACTATAAGCAGCCCATCATTGTAGGTCCCATGGAAGAGGAAATCATGACTGCCGGC
CCACACGACCATGTTGTCTGCTTTGGAGCCCTCCACTTTCTTCAGCCCGTCATGTTTAACGCTGTGCTGGCCAAG
ATGTTTATGCTGGCGCGGAAATCCGTCTCGTTTGACATTGACGACGTTCCCCCGTCCTACATTGATTTCCTCCGC
GACAATCATGGTCAGCTATTCATCAACTACAACCACGTGGAAGAAATGGAGCAGTTTGGAGTGCCCAAGGCATGG
AAGCTTGTCCACAAGTCGCATGAATTTCTCTTTACCTCGCCCCATGCTGGCCACGACATCTTTGGTTATGCCTTG
CGTTTTGAGCGGCTTTAG
Transcript >OphauB2|1878
ATGAAAATTTGTCTCATAAACTCGTCCTATGAGGGCGCCAACTCGCCCTTTGAAGCGGCGAGTTATGACCCTCTG
CCGGATCCGAGTCGCTACATTCCCGAGGGGCGCCATGAGTTTGTGTCCAAGTTTGTCACAAAGGCCAATGCCAAG
GCTGAGATTGACGAGATTTGCAAGGAAAAGTATGACTTGTTTTTCAACTACATGTGGGGCCTCGAGTCGGACAAT
GTTGCCGGCCTCGACGCCACCCTCTACCTAGAGAGCAAGGGCATCCCCATTCTGGGCCAGCCGTCCAGCTTTCTA
TCCAAGACCAAGCTGCATCTTGCCAAGGCGGCCAAGCTATCGGGACTGCGCATGCCGCAAAATACGCCTGGCAAA
TACCCCAAAATCGTCAAACATGCCACGACTTGCGGCTCGCTTGGACTCGACTACGACTCCGTCTGCCACGACGAG
GCGGCTGTCAAGCGACGGATAGCCCATCTCCAGCAGGTCGACGACACTCCTCTCCTAGTTTCCGACTACATCACT
GGCGCCGAGTGCTCAGCCATGGTGATTGAGACGGGAAGAGACGTGGTGGCGCTGACGCCGCTCAAGTACGTCTTC
CCCCCGGGCACTCCACCAGAACAGGCCTTTTTGACGTGGCACAACAAATTCGAGGCCTGTGAGGATGGAACAATC
ACCTATGCTCTAGTCGAGGGCAAGGAAAAGGCCAGTCTGCAAAAGGCAGCCGTTGACGCCTTCAAGGCCCTCAAG
ATCAAGGGCGGGGCCTGGGCACGAGTCGACATGCGGCTTGAAGACGGCACAAACGACGTCTATGTGCTCGAGGTC
AACTCGATCCCCGTCGTCTTCTACCCCAGGGGGAACAAGCTGGGCGACGACTTGGTGGTGGAAGAAACCTTTCCC
GGCGCCCATCTGGCCTTTATGGATATGCTGCTGGCAACCAAGATGATGCAGCTGGGCCTGCACAAGAAGCAGACC
AAACACTTGGCCTCGGTCTATGACAAGTTTGCCCCTAGCTACGATGGAGTTTGGCGTGCTGCCGGCCTGCGCAAG
GTGCAGGAGTTGATGGTGCGTAAGTTTGATTTTGGCGGAACGGTGCTGGACCTGGCCTGTGGCACTGGGGCCGTT
GGCCGCGTCTTGCACGAGGCGGGCATCGAGGCCGAAATCACGGGTATTGAAGTCTCAGAGGGCATGCTGCAGTCG
TCGCCCGACATTCACCAGCACTATAAGCAGCCCATCATTGTAGGTCCCATGGAAGAGGAAATCATGACTGCCGGC
CCACACGACCATGTTGTCTGCTTTGGAGCCCTCCACTTTCTTCAGCCCGTCATGTTTAACGCTGTGCTGGCCAAG
ATGTTTATGCTGGCGCGGAAATCCGTCTCGTTTGACATTGACGACGTTCCCCCGTCCTACATTGATTTCCTCCGC
GACAATCATGGTCAGCTATTCATCAACTACAACCACGTGGAAGAAATGGAGCAGTTTGGAGTGCCCAAGGCATGG
AAGCTTGTCCACAAGTCGCATGAATTTCTCTTTACCTCGCCCCATGCTGGCCACGACATCTTTGGTTATGCCTTG
CGTTTTGAGCGGCTTTAG
Gene >OphauB2|1878
ATGAAAATTTGTCTCATAAACTCGTCCTATGAGGGCGCCAACTCGCCCTTTGAAGCGGCGAGTGTGTCTGGCTGG
TGCCCGGTGTTTGTGGGCTGACTGATTTTCAGTATGACCCTCTGCCGGATCCGAGTCGCTACATTCCCGAGGGGC
GCCATGAGTTTGTGTCCAAGTTTGTCACAAAGGCCAATGCCAAGGCTGAGATTGACGAGATTTGCAAGGAAAAGT
ATGACTTGTTTTTCAACTACATGGTACGCTTGACTCTTTTCCATATTCTCCTCCTCTTGTACTCTATACGGCGCG
TCTACTCCATGATGCATCTACCCTCTACTACCTCTACTAATACTTACGACTGGTTGCTCATCTTTGCTGCAGTGG
GGCCTCGAGTCGGACAATGTTGCCGGCCTCGACGCCACCCTCTACCTAGAGAGCAAGGGCATCCCCATTCTGGGC
CAGCCGTCCAGCTTTCTATCCAAGACCAAGCTGCATCTTGCCAAGGCGGCCAAGCTATCGGGACTGCGCATGCCG
CAAAATACGCCTGGCAAATACCCCAAAATCGTCAAACATGCCACGACTTGCGGCTCGCTTGGACTCGACTACGAC
TCCGTCTGCCACGACGAGGCGGCTGTCAAGCGACGGATAGCCCATCTCCAGCAGGTCGACGACACTCCTCTCCTA
GTTTCCGACTACATCACTGGCGCCGAGTGCTCAGCCATGGTGATTGAGACGGGAAGAGACGTGGTGGCGCTGACG
CCGCTCAAGTACGTCTTCCCCCCGGGCACTCCACCAGAACAGGCCTTTTTGACGTGGCACAACAAATTCGAGGCC
TGTGAGGATGGAACAATCACCTATGCTCTAGTCGAGGGCAAGGAAAAGGCCAGTCTGCAAAAGGCAGCCGTTGAC
GCCTTCAAGGCCCTCAAGATCAAGGGCGGGGCCTGGGCACGAGTCGACATGCGGCTTGAAGACGGCACAAACGAC
GTCTATGTGCTCGAGGTCAACTCGATCCCCGTCGTCTTCTACCCCAGGGGGAACAAGCTGGGCGACGACTTGGTG
GTGGAAGAAACCTTTCCCGGCGCCCATCTGGCCTTTATGGATATGCTGCTGGCAACCAAGATGATGCAGCTGGGC
CTGCACAAGAAGCAGACCAAACACTTGGCCTCGGTCTATGACAAGTTTGCCCCTAGCTACGATGGAGTTTGGCGT
GCTGCCGGCCTGCGCAAGGTGCAGGAGTTGATGGTGCGTAAGTTTGATTTTGGCGGAACGGTGCTGGACCTGGCC
TGTGGCACTGGGGCCGTTGGCCGCGTCTTGCACGAGGCGGGCATCGAGGCCGAAATCACGGGTATTGAAGTCTCA
GAGGGCATGCTGCAGTCGTCGCCCGACATTCACCAGCACTATAAGCAGCCCATCATTGTAGGTCCCATGGAAGAG
GAAATCATGGTGAGTCGAGTCGAGTCTCCAGACGCGTAGAGGCCGCCATTTGACATGTCCTTGTCCAGACTGCCG
GCCCACACGACCATGTTGTCTGCTTTGGAGCCCTCCACTTTCTTCAGCCCGTCATGTTTAACGCTGTGCTGGCCA
AGATGTTTATGCTGGCGCGGAAATCCGTCTCGTTTGACATTGACGACGTTCCCCCGTCCTACATTGATTTCCTCC
GCGACAATCATGGTCAGCTATTCATCAACTACAACCACGTGGAAGAAATGGAGCAGTTTGGAGTGCCCAAGGCAT
GGAAGCTTGTCCACAAGTCGCATGAATTTCTCTTTACCTCGCCCCATGCTGGCCACGACATCTTTGGTTATGCCT
TGCGTTTTGAGCGGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail