Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1865
Gene name
LocationContig_153:39959..41861
Strand-
Gene length (bp)1902
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CID CID domain 1.6E-24 34 162

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5403
Ophiocordyceps australis map64 (Brazil) OphauB2|1865 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03505
Ophiocordyceps camponoti-rufipedis Ophun1|5554
Ophiocordyceps kimflemingae Ophio5|7544
Ophiocordyceps subramaniannii Hirsu2|9054

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1865
MADLAIAKAAFAASLMRSDPSPLSRGAVDEITALLNKTLDECSRSNVQKCKNWIVAHIVASPGRTTLLGKYLVAL
SESSDTDFDRPSVKKRRLRLLYIVNDVVHHALVKLDNQTLVPALEPHLPAMVAAASSFERSPRHLAKVSGLIDLW
QERQHVPPALIDGLRDSFSRASDKNSGTRIHMTDDELEQAKAAPYILPEQHGESLGPWNDLPAAVLLDQLRPSST
IPLRRGQMHPVQLKSGPASDAIQQAVCLTISEVDDLFSPDNIGGENEEDMNALGERGRLNKQTGELEMGSYYGWS
RAFCQQQKARSNRPAPSPSRGRKRHHSPRRRSYSRSRSRSRSRSRTRSYSPSRSRSSSRASHRGRSPRRASYSPS
PGPTSRHGPPSQRRSRSRSRSRDRARAPPLAMAPQPTAAALPIPPPPPPFPGAFQQGLGFVPPPPPPLPPNLAGP
WGPANAPPPPPPPPPPPPHAPLQNPQHGWNWAPHRGTGRGTRGRGQGAPAVHGSYGYPYQR*
Coding >OphauB2|1865
ATGGCAGATTTGGCCATTGCCAAAGCCGCCTTTGCGGCCTCGCTCATGCGTTCCGATCCTAGTCCGCTTTCTCGA
GGCGCCGTTGACGAAATCACGGCTCTGCTCAACAAGACTCTAGACGAGTGCTCGCGTTCCAATGTCCAGAAATGC
AAGAACTGGATCGTGGCTCACATCGTTGCCTCCCCGGGACGCACCACCCTGCTGGGCAAATACCTCGTCGCCCTG
TCTGAGAGCTCAGACACAGACTTTGATCGGCCCAGCGTCAAGAAGCGGAGACTACGACTGCTCTACATTGTCAAT
GATGTCGTGCACCACGCCCTGGTCAAGCTGGATAATCAGACTCTTGTTCCTGCGCTGGAGCCTCACCTGCCCGCC
ATGGTTGCTGCTGCCTCGAGCTTTGAAAGGAGTCCTCGGCATTTGGCCAAGGTGTCGGGCCTCATTGACTTGTGG
CAAGAGCGCCAACACGTGCCCCCAGCTCTGATTGACGGCTTGCGCGACTCGTTTTCGCGTGCCTCGGACAAGAAC
TCGGGAACTCGCATCCACATGACGGACGACGAGCTTGAGCAGGCCAAGGCGGCGCCGTACATTTTGCCAGAGCAA
CACGGCGAATCGCTGGGGCCTTGGAACGACTTACCGGCCGCGGTGCTGCTGGATCAGCTGCGTCCAAGTTCAACC
ATTCCCCTGCGCCGGGGCCAGATGCATCCGGTTCAGCTCAAGTCGGGACCTGCGTCGGATGCGATTCAACAGGCT
GTTTGTCTGACTATTTCCGAGGTGGATGACCTCTTTTCCCCGGACAATATTGGCGGCGAGAATGAAGAAGACATG
AATGCCCTGGGAGAAAGAGGTCGGCTCAACAAGCAGACTGGAGAGCTCGAGATGGGCTCCTACTATGGCTGGTCA
AGGGCCTTTTGCCAGCAACAAAAGGCCCGGTCAAACAGGCCAGCCCCGTCTCCGTCAAGAGGCCGCAAAAGACAC
CACAGCCCAAGAAGACGGTCGTATAGCCGCAGCCGAAGCCGCAGTCGCAGTCGCAGCCGCACTCGAAGCTACAGC
CCGAGTCGGAGCCGCAGCTCAAGCAGAGCATCGCATCGAGGACGCAGCCCCAGACGCGCCTCGTATTCCCCAAGC
CCTGGTCCCACTTCGCGTCACGGCCCACCAAGTCAGCGCCGCTCCCGCTCCCGCTCCCGCTCCCGCGACCGGGCC
CGAGCTCCTCCTTTAGCCATGGCTCCCCAACCAACCGCTGCCGCTTTGCCCATTCCGCCCCCGCCACCCCCCTTC
CCGGGCGCCTTTCAGCAAGGCCTCGGCTTCGTGCCCCCGCCTCCTCCTCCTCTCCCTCCCAACCTTGCCGGCCCG
TGGGGTCCCGCCAATGCACCCCCTCCTCCTCCTCCTCCGCCGCCGCCGCCGCCCCATGCCCCTCTGCAAAATCCC
CAGCATGGCTGGAACTGGGCGCCTCATCGGGGAACTGGGCGCGGCACCCGCGGTCGCGGCCAGGGCGCCCCAGCC
GTCCACGGCTCCTACGGCTATCCTTACCAACGATGA
Transcript >OphauB2|1865
ATGGCAGATTTGGCCATTGCCAAAGCCGCCTTTGCGGCCTCGCTCATGCGTTCCGATCCTAGTCCGCTTTCTCGA
GGCGCCGTTGACGAAATCACGGCTCTGCTCAACAAGACTCTAGACGAGTGCTCGCGTTCCAATGTCCAGAAATGC
AAGAACTGGATCGTGGCTCACATCGTTGCCTCCCCGGGACGCACCACCCTGCTGGGCAAATACCTCGTCGCCCTG
TCTGAGAGCTCAGACACAGACTTTGATCGGCCCAGCGTCAAGAAGCGGAGACTACGACTGCTCTACATTGTCAAT
GATGTCGTGCACCACGCCCTGGTCAAGCTGGATAATCAGACTCTTGTTCCTGCGCTGGAGCCTCACCTGCCCGCC
ATGGTTGCTGCTGCCTCGAGCTTTGAAAGGAGTCCTCGGCATTTGGCCAAGGTGTCGGGCCTCATTGACTTGTGG
CAAGAGCGCCAACACGTGCCCCCAGCTCTGATTGACGGCTTGCGCGACTCGTTTTCGCGTGCCTCGGACAAGAAC
TCGGGAACTCGCATCCACATGACGGACGACGAGCTTGAGCAGGCCAAGGCGGCGCCGTACATTTTGCCAGAGCAA
CACGGCGAATCGCTGGGGCCTTGGAACGACTTACCGGCCGCGGTGCTGCTGGATCAGCTGCGTCCAAGTTCAACC
ATTCCCCTGCGCCGGGGCCAGATGCATCCGGTTCAGCTCAAGTCGGGACCTGCGTCGGATGCGATTCAACAGGCT
GTTTGTCTGACTATTTCCGAGGTGGATGACCTCTTTTCCCCGGACAATATTGGCGGCGAGAATGAAGAAGACATG
AATGCCCTGGGAGAAAGAGGTCGGCTCAACAAGCAGACTGGAGAGCTCGAGATGGGCTCCTACTATGGCTGGTCA
AGGGCCTTTTGCCAGCAACAAAAGGCCCGGTCAAACAGGCCAGCCCCGTCTCCGTCAAGAGGCCGCAAAAGACAC
CACAGCCCAAGAAGACGGTCGTATAGCCGCAGCCGAAGCCGCAGTCGCAGTCGCAGCCGCACTCGAAGCTACAGC
CCGAGTCGGAGCCGCAGCTCAAGCAGAGCATCGCATCGAGGACGCAGCCCCAGACGCGCCTCGTATTCCCCAAGC
CCTGGTCCCACTTCGCGTCACGGCCCACCAAGTCAGCGCCGCTCCCGCTCCCGCTCCCGCTCCCGCGACCGGGCC
CGAGCTCCTCCTTTAGCCATGGCTCCCCAACCAACCGCTGCCGCTTTGCCCATTCCGCCCCCGCCACCCCCCTTC
CCGGGCGCCTTTCAGCAAGGCCTCGGCTTCGTGCCCCCGCCTCCTCCTCCTCTCCCTCCCAACCTTGCCGGCCCG
TGGGGTCCCGCCAATGCACCCCCTCCTCCTCCTCCTCCGCCGCCGCCGCCGCCCCATGCCCCTCTGCAAAATCCC
CAGCATGGCTGGAACTGGGCGCCTCATCGGGGAACTGGGCGCGGCACCCGCGGTCGCGGCCAGGGCGCCCCAGCC
GTCCACGGCTCCTACGGCTATCCTTACCAACGATGA
Gene >OphauB2|1865
ATGGCAGATTTGGCCATTGCCAAAGCCGCCTTTGCGGCCTCGCTCATGCGTTCCGATCCTAGTCCGCTTTCTCGA
GGCGCCGTTGACGAAATCACGGCTCTGCTCAACAAGACTCTAGACGAGTGCTCGCGTTCCAATGTCCAGGTTTGC
CTTTTTTCACTCAGCAGAGCCCCCGGCTCAACTTGCACATGAGGCCCTTTTTTTCTTTTTTTTTTCTTTTTTTTT
CTTTATAATAATATTCTCGTGTCGTCAAAATGAAGAGAGAGAATCAGTTGCTAAGACTTCAGCGTGTTTATTCTT
TGACTGGTAGAAATGCAAGAACTGGATCGTGGCTCACATCGTTGCCTCCCCGGGACGCACCACCCTGCTGGGCAA
ATACCTCGTCGCCCTGTCTGAGAGCTCAGACACAGACTTTGATCGGCCCAGCGTCAAGAAGCGGAGACTACGACT
GCTCTACATTGTCAATGATGTCGTGCACCACGCCCTGGTCAAGCTGGATAATCAGACTCTTGTTCCTGCGCTGGA
GCCTCACCTGCCCGCCATGGTTGCTGCTGCCTCGAGCTTTGAAAGGAGTCCTCGGCATTTGGCCAAGGTGTCGGG
CCTCATTGACTTGTGGCAAGAGCGCCAACACGTGCCCCCAGCTCTGATTGACGGCTTGCGCGACTCGTTTTCGCG
TGCCTCGGACAAGAACTCGGGAACTCGCATCCACATGACGGACGACGAGCTTGAGCAGGCCAAGGCGGCGCCGTA
CATTTTGCCAGAGCAACACGGCGAATCGCTGGGGCCTTGGAACGACTTACCGGCCGCGGTGCTGCTGGATCAGCT
GCGTCCAAGTTCAACCATTCCCCTGCGCCGGGGCCAGATGCATCCGGTTCAGCTCAAGTCGGGACCTGCGTCGGA
TGCGATTCAACAGGCTGTTTGTCTGACTATTTCCGAGGTGGATGACCTCTTTTCCCCGGACAATATTGGCGGCGA
GAATGAAGAAGACATGAATGCCCTGGGAGAAAGAGGTCGGCTCAACAAGCAGACTGGAGAGCTCGAGATGGGCTC
CTACTATGGCTGGTCAAGGGCCTTTTGCCAGCAACAAAAGGCCCGGTCAAACAGGCCAGCCCCGTCTCCGTCAAG
AGGCCGCAAAAGACACCACAGCCCAAGGTGCGCAGTCTCAATCGAGTTTGTTGCTTGGCGACTAACGTCTTGTAT
AGAAGACGGTCGTATAGCCGCAGCCGAAGCCGCAGTCGCAGTCGCAGCCGCACTCGAAGCTACAGCCCGAGTCGG
AGCCGCAGCTCAAGGTACAAAGGCACCTCATTGCTCTCAGCCAATGCCACTATCGCCTAACAAGTGCCACAGCAG
AGCATCGCATCGAGGACGCAGCCCCAGGTATGTTTTGACCCCACCAAGCCCCCCCCCCCCCNNAACCCCCCCAGC
CCCCCCCCCCCCCACCAAGATTCTTTTACCAACTCGCCCGCCAGACGCGCCTCGTATTCCCCAAGCCCTGGTCCC
ACTTCGCGTCACGGCCCACCAAGTCAGCGCCGCTCCCGCTCCCGCTCCCGCTCCCGCGACCGGGCCCGAGCTCCT
CCTTTAGCCATGGCTCCCCAACCAACCGCTGCCGCTTTGCCCATTCCGCCCCCGCCACCCCCCTTCCCGGGCGCC
TTTCAGCAAGGCCTCGGCTTCGTGCCCCCGCCTCCTCCTCCTCTCCCTCCCAACCTTGCCGGCCCGTGGGGTCCC
GCCAATGCACCCCCTCCTCCTCCTCCTCCGCCGCCGCCGCCGCCCCATGCCCCTCTGCAAAATCCCCAGCATGGC
TGGAACTGGGCGCCTCATCGGGGAACTGGGCGCGGCACCCGCGGTCGCGGCCAGGGCGCCCCAGCCGTCCACGGC
TCCTACGGCTATCCTTACCAACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail