Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1863
Gene name
LocationContig_153:32360..34474
Strand-
Gene length (bp)2114
Transcript length (bp)1983
Coding sequence length (bp)1983
Protein length (aa) 661

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09734 Tau95 RNA polymerase III transcription factor (TF)IIIC subunit HTH domain 1.3E-35 223 368
PF17682 Tau95_N Tau95 Triple barrel domain 1.4E-34 40 182

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14229|SFC1_SCHPO Transcription factor tau subunit sfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfc1 PE=1 SV=2 163 465 2.0E-42
sp|Q54GS8|TF3C5_DICDI General transcription factor 3C polypeptide 5 OS=Dictyostelium discoideum GN=gtf3c5 PE=3 SV=1 33 373 3.0E-18
sp|P32367|TFC1_YEAST Transcription factor tau 95 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFC1 PE=1 SV=1 94 462 3.0E-17
sp|Q9Y5Q8|TF3C5_HUMAN General transcription factor 3C polypeptide 5 OS=Homo sapiens GN=GTF3C5 PE=1 SV=2 36 369 8.0E-16
sp|Q8R2T8|TF3C5_MOUSE General transcription factor 3C polypeptide 5 OS=Mus musculus GN=Gtf3c5 PE=2 SV=2 36 369 5.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1863
MASFNHQDEANNESDVDWPDEHETVDEAPRYRLPCRRLTAVEIPAVVNNVDRCIKAFGRGPSLSHVLDPSRSSVP
LFLNPESPFCPPIMSHNARSHNVVLKITLPKRTGRKRKRGTNDPWQGDMDLDHAGSAPNEPNVCSIARLDEPQVL
RQKLADNVDKYQVQAVGVIKRTHRFRGLADFYWDVSKSPFAQQYVQKVLPGDVNSIKTFKYAPGIHQGPNVDILP
PPLFTHMSLPFNYNFSQNPYVQHTEDGGTFNKTAVPQVGYFIGAYDAVPLGPQLAPDMTDVNTVQVIAQLEEAFQ
QRPLWTRRSLMNYLGNNGVIRNWNDLKKYLNYTAYQFKGGPWRDSVVPYGVDPRTDPRYRIYQTLMFKMSRKNRF
KGQTWQSLRKSQVNSVEDYGQGQEPTHIFDGETFHTDGKVWQVCDITDPLIKELLDSAEVRPTWDINSGWYHGGL
WAKVKAIMKTKLVAIQFGRQVTRQEFASTLACGDQTPTRGSSNTLHLPLPNLNLTNEELVLLRGHEPPKKKSSGY
NVRFQGLSINRPEGDPGTSEPTVDSVADEEEAAMQIVWDNEADEDEDEDADVGEDEDGEQDEYEYGDEDEDEDEA
NEGDEAEYPGRASFSIGGYHDDDGGGYAGNQISHGVGPYQVANEDDYEDTDESDEFGLGT*
Coding >OphauB2|1863
ATGGCCTCATTCAACCACCAAGACGAGGCCAATAACGAGTCTGATGTCGATTGGCCCGACGAGCACGAGACGGTC
GACGAGGCGCCACGCTATCGCCTGCCATGTCGGCGATTGACGGCTGTTGAGATTCCCGCAGTTGTGAACAATGTC
GACCGTTGCATCAAAGCCTTTGGCAGAGGTCCATCATTATCCCACGTCCTCGACCCGTCGAGGAGCTCGGTGCCG
CTCTTCTTGAACCCTGAAAGCCCCTTTTGCCCGCCCATCATGTCCCACAATGCGAGGTCGCACAATGTAGTCCTC
AAGATTACGCTTCCGAAGCGCACTGGCCGCAAGAGGAAGCGAGGCACCAATGATCCTTGGCAGGGCGACATGGAT
CTTGACCATGCTGGCTCTGCCCCAAACGAGCCAAATGTCTGCTCTATTGCGCGCCTTGACGAGCCCCAGGTGCTA
CGGCAAAAGCTGGCCGACAATGTCGACAAGTACCAAGTCCAGGCTGTTGGTGTCATTAAGCGCACCCATCGCTTC
AGAGGACTAGCCGACTTTTACTGGGATGTGTCCAAGTCTCCATTTGCTCAGCAATATGTCCAAAAGGTCTTGCCA
GGAGATGTCAACTCCATCAAGACATTCAAGTATGCCCCGGGCATACACCAGGGTCCCAATGTGGACATTTTGCCA
CCACCTCTCTTCACACACATGAGCTTACCCTTCAACTACAATTTCTCGCAAAATCCATATGTGCAGCACACCGAG
GATGGCGGAACCTTTAACAAGACTGCTGTGCCTCAAGTGGGATATTTCATTGGTGCCTATGATGCTGTGCCTTTG
GGACCCCAACTGGCCCCAGACATGACAGATGTCAACACGGTGCAAGTCATTGCGCAGCTCGAGGAAGCATTTCAG
CAACGCCCTCTCTGGACCCGCCGCTCCCTAATGAATTATTTAGGAAACAATGGCGTCATTCGCAACTGGAACGAC
CTCAAGAAATATCTCAACTATACGGCATACCAATTCAAGGGCGGGCCGTGGAGAGACAGTGTGGTGCCTTATGGC
GTTGATCCCAGAACAGACCCTAGATACCGCATCTATCAAACTCTCATGTTCAAGATGTCGAGGAAGAATCGCTTC
AAGGGTCAGACATGGCAATCTCTTAGAAAGTCCCAGGTCAACTCTGTAGAGGACTATGGACAAGGGCAGGAGCCT
ACACACATTTTTGACGGTGAAACGTTTCACACAGACGGCAAGGTGTGGCAAGTGTGCGATATTACCGACCCTCTC
ATCAAGGAGCTCTTGGATTCGGCTGAAGTTCGGCCCACATGGGACATAAACAGCGGATGGTATCATGGTGGACTC
TGGGCCAAGGTTAAGGCTATTATGAAAACCAAACTGGTGGCAATACAGTTTGGAAGACAAGTAACGCGTCAAGAA
TTCGCGTCGACATTGGCGTGTGGGGATCAAACGCCTACCAGAGGTTCTTCGAATACCCTCCACCTGCCATTGCCA
AATCTTAACCTGACAAACGAGGAACTTGTCTTGTTGCGTGGGCACGAGCCACCAAAGAAGAAGAGTTCGGGATAC
AATGTGCGCTTCCAAGGGCTCTCTATAAACAGACCTGAGGGCGACCCAGGTACTAGTGAGCCGACTGTAGATTCG
GTCGCTGATGAGGAGGAGGCTGCCATGCAAATAGTTTGGGACAATGAAGCCGACGAGGACGAGGATGAGGACGCC
GATGTGGGCGAAGACGAAGATGGAGAGCAAGATGAATATGAATATGGAGACGAAGATGAAGACGAAGACGAAGCA
AACGAAGGAGACGAGGCGGAATATCCTGGACGAGCATCTTTTAGCATCGGTGGCTACCACGATGACGATGGAGGA
GGGTATGCTGGCAATCAAATCAGCCATGGCGTCGGTCCATACCAAGTGGCAAACGAAGACGATTACGAGGACACT
GACGAGTCTGATGAGTTTGGCCTTGGTACGTGA
Transcript >OphauB2|1863
ATGGCCTCATTCAACCACCAAGACGAGGCCAATAACGAGTCTGATGTCGATTGGCCCGACGAGCACGAGACGGTC
GACGAGGCGCCACGCTATCGCCTGCCATGTCGGCGATTGACGGCTGTTGAGATTCCCGCAGTTGTGAACAATGTC
GACCGTTGCATCAAAGCCTTTGGCAGAGGTCCATCATTATCCCACGTCCTCGACCCGTCGAGGAGCTCGGTGCCG
CTCTTCTTGAACCCTGAAAGCCCCTTTTGCCCGCCCATCATGTCCCACAATGCGAGGTCGCACAATGTAGTCCTC
AAGATTACGCTTCCGAAGCGCACTGGCCGCAAGAGGAAGCGAGGCACCAATGATCCTTGGCAGGGCGACATGGAT
CTTGACCATGCTGGCTCTGCCCCAAACGAGCCAAATGTCTGCTCTATTGCGCGCCTTGACGAGCCCCAGGTGCTA
CGGCAAAAGCTGGCCGACAATGTCGACAAGTACCAAGTCCAGGCTGTTGGTGTCATTAAGCGCACCCATCGCTTC
AGAGGACTAGCCGACTTTTACTGGGATGTGTCCAAGTCTCCATTTGCTCAGCAATATGTCCAAAAGGTCTTGCCA
GGAGATGTCAACTCCATCAAGACATTCAAGTATGCCCCGGGCATACACCAGGGTCCCAATGTGGACATTTTGCCA
CCACCTCTCTTCACACACATGAGCTTACCCTTCAACTACAATTTCTCGCAAAATCCATATGTGCAGCACACCGAG
GATGGCGGAACCTTTAACAAGACTGCTGTGCCTCAAGTGGGATATTTCATTGGTGCCTATGATGCTGTGCCTTTG
GGACCCCAACTGGCCCCAGACATGACAGATGTCAACACGGTGCAAGTCATTGCGCAGCTCGAGGAAGCATTTCAG
CAACGCCCTCTCTGGACCCGCCGCTCCCTAATGAATTATTTAGGAAACAATGGCGTCATTCGCAACTGGAACGAC
CTCAAGAAATATCTCAACTATACGGCATACCAATTCAAGGGCGGGCCGTGGAGAGACAGTGTGGTGCCTTATGGC
GTTGATCCCAGAACAGACCCTAGATACCGCATCTATCAAACTCTCATGTTCAAGATGTCGAGGAAGAATCGCTTC
AAGGGTCAGACATGGCAATCTCTTAGAAAGTCCCAGGTCAACTCTGTAGAGGACTATGGACAAGGGCAGGAGCCT
ACACACATTTTTGACGGTGAAACGTTTCACACAGACGGCAAGGTGTGGCAAGTGTGCGATATTACCGACCCTCTC
ATCAAGGAGCTCTTGGATTCGGCTGAAGTTCGGCCCACATGGGACATAAACAGCGGATGGTATCATGGTGGACTC
TGGGCCAAGGTTAAGGCTATTATGAAAACCAAACTGGTGGCAATACAGTTTGGAAGACAAGTAACGCGTCAAGAA
TTCGCGTCGACATTGGCGTGTGGGGATCAAACGCCTACCAGAGGTTCTTCGAATACCCTCCACCTGCCATTGCCA
AATCTTAACCTGACAAACGAGGAACTTGTCTTGTTGCGTGGGCACGAGCCACCAAAGAAGAAGAGTTCGGGATAC
AATGTGCGCTTCCAAGGGCTCTCTATAAACAGACCTGAGGGCGACCCAGGTACTAGTGAGCCGACTGTAGATTCG
GTCGCTGATGAGGAGGAGGCTGCCATGCAAATAGTTTGGGACAATGAAGCCGACGAGGACGAGGATGAGGACGCC
GATGTGGGCGAAGACGAAGATGGAGAGCAAGATGAATATGAATATGGAGACGAAGATGAAGACGAAGACGAAGCA
AACGAAGGAGACGAGGCGGAATATCCTGGACGAGCATCTTTTAGCATCGGTGGCTACCACGATGACGATGGAGGA
GGGTATGCTGGCAATCAAATCAGCCATGGCGTCGGTCCATACCAAGTGGCAAACGAAGACGATTACGAGGACACT
GACGAGTCTGATGAGTTTGGCCTTGGTACGTGA
Gene >OphauB2|1863
ATGGCCTCATTCAACCACCAAGACGAGGCCAATAACGAGTCTGATGTCGATTGGCCCGACGAGCACGAGACGGTC
GACGAGGCGCCACGCTATCGCCTGCCATGTCGGCGATTGACGGCTGTTGAGATTCCCGCAGTTGTGAACAATGTC
GACCGTTGCATCAAAGCCTTTGGCAGAGGTCCATCATTATCCCACGTGAGTTTCAGGCCTGGATCAACCGACATT
ACAGCTGCAGCTAGTAATCTGGCGCTAAGTCTCTCGTCTAGGTCCTCGACCCGTCGAGGAGCTCGGTGCCGCTCT
TCTTGAACCCTGAAAGCCCCTTTTGCCCGCCCATCATGTCCCACAATGCGAGGTCGCACAATGTAGTCCTCAAGA
TTACGCTTCCGAAGCGCACTGGCCGCAAGAGGAAGCGAGGCACCAATGATCCTTGGCAGGGCGACATGGATCTTG
ACCATGCTGGCTCTGCCCCAAACGAGCCAAATGTCTGCTCTATTGCGCGCCTTGACGAGCCCCAGGTGCTACGGC
AAAAGCTGGCCGACAATGTCGACAAGTACCAAGTCCAGGCTGTTGGTGTCATTAAGCGCACCCATCGCTTCAGAG
GACTAGCCGACTTTTACTGGGATGTGTCCAAGTCTCCATTTGCTCAGCAATATGTCCAAAAGGTCTTGCCAGGAG
ATGGTATGTCTTGACAGCAAGAGCAAATCAAGTGGCTAGATCAAGTGGCTAAATAGTTTGCAGTCAACTCCATCA
AGACATTCAAGTATGCCCCGGGCATACACCAGGGTCCCAATGTGGACATTTTGCCACCACCTCTCTTCACACACA
TGAGCTTACCCTTCAACTACAATTTCTCGCAAAATCCATATGTGCAGCACACCGAGGATGGCGGAACCTTTAACA
AGACTGCTGTGCCTCAAGTGGGATATTTCATTGGTGCCTATGATGCTGTGCCTTTGGGACCCCAACTGGCCCCAG
ACATGACAGATGTCAACACGGTGCAAGTCATTGCGCAGCTCGAGGAAGCATTTCAGCAACGCCCTCTCTGGACCC
GCCGCTCCCTAATGAATTATTTAGGAAACAATGGCGTCATTCGCAACTGGAACGACCTCAAGAAATATCTCAACT
ATACGGCATACCAATTCAAGGGCGGGCCGTGGAGAGACAGTGTGGTGCCTTATGGCGTTGATCCCAGAACAGACC
CTAGATACCGCATCTATCAAACTCTCATGTTCAAGATGTCGAGGAAGAATCGCTTCAAGGGTCAGACATGGCAAT
CTCTTAGAAAGTCCCAGGTCAACTCTGTAGAGGACTATGGACAAGGGCAGGAGCCTACACACATTTTTGACGGTG
AAACGTTTCACACAGACGGCAAGGTGTGGCAAGTGTGCGATATTACCGACCCTCTCATCAAGGAGCTCTTGGATT
CGGCTGAAGTTCGGCCCACATGGGACATAAACAGCGGATGGTATCATGGTGGACTCTGGGCCAAGGTTAAGGCTA
TTATGAAAACCAAACTGGTGGCAATACAGTTTGGAAGACAAGTAACGCGTCAAGAATTCGCGTCGACATTGGCGT
GTGGGGATCAAACGCCTACCAGAGGTTCTTCGAATACCCTCCACCTGCCATTGCCAAATCTTAACCTGACAAACG
AGGAACTTGTCTTGTTGCGTGGGCACGAGCCACCAAAGAAGAAGAGTTCGGGATACAATGTGCGCTTCCAAGGGC
TCTCTATAAACAGACCTGAGGGCGACCCAGGTACTAGTGAGCCGACTGTAGATTCGGTCGCTGATGAGGAGGAGG
CTGCCATGCAAATAGTTTGGGACAATGAAGCCGACGAGGACGAGGATGAGGACGCCGATGTGGGCGAAGACGAAG
ATGGAGAGCAAGATGAATATGAATATGGAGACGAAGATGAAGACGAAGACGAAGCAAACGAAGGAGACGAGGCGG
AATATCCTGGACGAGCATCTTTTAGCATCGGTGGCTACCACGATGACGATGGAGGAGGGTATGCTGGCAATCAAA
TCAGCCATGGCGTCGGTCCATACCAAGTGGCAAACGAAGACGATTACGAGGACACTGACGAGTCTGATGAGTTTG
GCCTTGGTACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail