Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1859
Gene name
LocationContig_153:14384..17861
Strand+
Gene length (bp)3477
Transcript length (bp)3477
Coding sequence length (bp)3477
Protein length (aa) 1159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain 1.6E-60 580 722
PF00387 PI-PLC-Y Phosphatidylinositol-specific phospholipase C, Y domain 9.8E-40 822 936

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40977|PLC1_SCHPO 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plc1 PE=1 SV=1 89 1110 5.0E-132
sp|Q32NH8|PLCD4_XENLA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Xenopus laevis GN=plcd4 PE=2 SV=1 281 1107 2.0E-78
sp|P21671|PLCD4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Bos taurus GN=PLCD4 PE=1 SV=2 279 1105 5.0E-78
sp|Q4R6L3|PLCD4_MACFA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Macaca fascicularis GN=PLCD4 PE=2 SV=1 279 1107 3.0E-72
sp|A5D6R3|PLD3A_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A OS=Danio rerio GN=plcd3a PE=2 SV=1 279 1107 7.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40977|PLC1_SCHPO 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plc1 PE=1 SV=1 89 1110 5.0E-132
sp|Q32NH8|PLCD4_XENLA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Xenopus laevis GN=plcd4 PE=2 SV=1 281 1107 2.0E-78
sp|P21671|PLCD4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Bos taurus GN=PLCD4 PE=1 SV=2 279 1105 5.0E-78
sp|Q4R6L3|PLCD4_MACFA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Macaca fascicularis GN=PLCD4 PE=2 SV=1 279 1107 3.0E-72
sp|A5D6R3|PLD3A_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A OS=Danio rerio GN=plcd3a PE=2 SV=1 279 1107 7.0E-72
sp|Q8N3E9|PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens GN=PLCD3 PE=1 SV=3 283 1107 4.0E-66
sp|Q4KWH8|PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens GN=PLCH1 PE=1 SV=1 281 1055 7.0E-66
sp|Q5FX52|PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus GN=Plcz1 PE=2 SV=1 579 1105 1.0E-65
sp|Q2VRL0|PLCZ1_CHICK 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Gallus gallus GN=PLCZ1 PE=2 SV=1 430 1105 2.0E-64
sp|Q8K4D7|PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus GN=Plcz1 PE=1 SV=1 579 1105 5.0E-63
sp|Q01970|PLCB3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens GN=PLCB3 PE=1 SV=2 281 1102 1.0E-62
sp|Q99JE6|PLCB3_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Rattus norvegicus GN=Plcb3 PE=1 SV=2 281 1102 4.0E-62
sp|Q7YRU3|PLCZ1_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Sus scrofa GN=PLCZ PE=2 SV=1 579 1105 5.0E-62
sp|Q15147|PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens GN=PLCB4 PE=1 SV=3 467 1105 6.0E-62
sp|Q95JS1|PLCZ1_MACFA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Macaca fascicularis GN=PLCZ1 PE=2 SV=1 430 1105 1.0E-61
sp|O75038|PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens GN=PLCH2 PE=2 SV=3 263 1055 3.0E-61
sp|Q9QW07|PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus GN=Plcb4 PE=1 SV=2 467 1105 6.0E-61
sp|Q1RML2|PLCZ1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Bos taurus GN=PLCZ1 PE=2 SV=1 575 1105 7.0E-61
sp|P51432|PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus GN=Plcb3 PE=1 SV=2 281 1102 2.0E-60
sp|Q07722|PLCB4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (Fragment) OS=Bos taurus GN=PLCB4 PE=1 SV=1 467 1105 3.0E-60
sp|Q8K394|PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus GN=Plcl2 PE=1 SV=2 281 1107 5.0E-59
sp|P10894|PLCB1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Bos taurus GN=PLCB1 PE=1 SV=1 475 1107 6.0E-59
sp|P10687|PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus GN=Plcb1 PE=1 SV=1 475 1107 8.0E-59
sp|Q9Z1B3|PLCB1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Mus musculus GN=Plcb1 PE=1 SV=2 475 1107 5.0E-58
sp|Q9NQ66|PLCB1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens GN=PLCB1 PE=1 SV=1 475 1107 2.0E-57
sp|P32383|PLC1_YEAST 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLC1 PE=1 SV=1 319 722 6.0E-57
sp|Q86YW0|PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens GN=PLCZ1 PE=2 SV=1 430 1105 1.0E-56
sp|O89040|PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus GN=Plcb2 PE=2 SV=1 472 1107 7.0E-53
sp|O13433|PLC1_CANAX 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Candida albicans GN=PLC1 PE=3 SV=1 323 722 1.0E-52
sp|O13433|PLC1_CANAX 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Candida albicans GN=PLC1 PE=3 SV=1 815 1108 1.0E-52
sp|Q00722|PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens GN=PLCB2 PE=1 SV=2 299 1055 2.0E-52
sp|Q5RET0|PLCD4_PONAB 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Pongo abelii GN=PLCD4 PE=2 SV=1 279 722 7.0E-52
sp|Q8K3R3|PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus GN=Plcd4 PE=1 SV=2 279 722 9.0E-52
sp|A3KGF7|PLCB2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Mus musculus GN=Plcb2 PE=1 SV=1 472 1107 9.0E-52
sp|Q62711|PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus GN=Plcd4 PE=1 SV=1 279 722 1.0E-51
sp|Q9BRC7|PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens GN=PLCD4 PE=2 SV=1 279 722 4.0E-51
sp|P16885|PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens GN=PLCG2 PE=1 SV=4 306 724 5.0E-51
sp|Q9UPR0|PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens GN=PLCL2 PE=1 SV=2 281 1107 6.0E-51
sp|Q8SPR7|PLCD4_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Sus scrofa GN=PLCD4 PE=2 SV=1 279 722 2.0E-50
sp|Q62688|PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus GN=Plcl1 PE=1 SV=1 281 1107 3.0E-48
sp|Q8CIH5|PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus GN=Plcg2 PE=1 SV=1 306 724 1.0E-46
sp|P24135|PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus GN=Plcg2 PE=1 SV=1 306 724 2.0E-46
sp|Q3USB7|PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus GN=Plcl1 PE=1 SV=3 281 1107 5.0E-46
sp|P10688|PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus GN=Plcd1 PE=1 SV=1 281 711 3.0E-45
sp|P08487|PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus GN=PLCG1 PE=1 SV=1 292 722 3.0E-45
sp|Q8K2J0|PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus GN=Plcd3 PE=1 SV=2 322 722 4.0E-45
sp|Q8R3B1|PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus GN=Plcd1 PE=1 SV=2 281 711 7.0E-45
sp|P10895|PLCD1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Bos taurus GN=PLCD1 PE=2 SV=2 281 712 9.0E-45
sp|P51178|PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens GN=PLCD1 PE=1 SV=2 281 711 2.0E-44
sp|A2AP18|PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus GN=Plch2 PE=1 SV=2 281 729 3.0E-44
sp|P19174|PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens GN=PLCG1 PE=1 SV=1 266 722 3.0E-44
sp|P10686|PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus GN=Plcg1 PE=1 SV=1 271 722 5.0E-44
sp|Q62077|PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus GN=Plcg1 PE=1 SV=2 263 722 1.0E-43
sp|Q02158|PLC_DICDI 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Dictyostelium discoideum GN=plc PE=2 SV=1 280 719 3.0E-42
sp|Q4KWH5|PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus GN=Plch1 PE=2 SV=1 281 722 1.0E-41
sp|G5EBH0|PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans GN=egl-8 PE=1 SV=1 467 726 1.0E-35
sp|Q9P212|PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens GN=PLCE1 PE=1 SV=3 552 711 7.0E-33
sp|P13217|PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster GN=norpA PE=1 SV=4 465 731 2.0E-32
sp|Q99P84|PLCE1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Rattus norvegicus GN=Plce1 PE=1 SV=1 579 712 3.0E-32
sp|Q8K4S1|PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus GN=Plce1 PE=1 SV=3 579 712 3.0E-32
sp|P25455|PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster GN=Plc21C PE=2 SV=3 458 701 1.0E-31
sp|Q15111|PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens GN=PLCL1 PE=1 SV=3 281 745 1.0E-31
sp|P19174|PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens GN=PLCG1 PE=1 SV=1 808 1109 4.0E-30
sp|P08487|PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus GN=PLCG1 PE=1 SV=1 808 1109 1.0E-29
sp|Q62077|PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus GN=Plcg1 PE=1 SV=2 808 1109 1.0E-29
sp|P10686|PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus GN=Plcg1 PE=1 SV=1 808 1109 1.0E-29
sp|P51178|PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens GN=PLCD1 PE=1 SV=2 821 1107 2.0E-24
sp|G5EBH0|PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans GN=egl-8 PE=1 SV=1 820 1105 3.0E-24
sp|P10895|PLCD1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Bos taurus GN=PLCD1 PE=2 SV=2 816 1105 8.0E-24
sp|Q9LY51|PLCD7_ARATH Phosphoinositide phospholipase C 7 OS=Arabidopsis thaliana GN=PLC7 PE=1 SV=1 557 721 9.0E-24
sp|Q39033|PLCD2_ARATH Phosphoinositide phospholipase C 2 OS=Arabidopsis thaliana GN=PLC2 PE=1 SV=1 557 737 1.0E-23
sp|Q8GV43|PLCD6_ARATH Phosphoinositide phospholipase C 6 OS=Arabidopsis thaliana GN=PLC6 PE=2 SV=2 558 721 2.0E-23
sp|P13217|PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster GN=norpA PE=1 SV=4 821 1107 3.0E-23
sp|P25455|PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster GN=Plc21C PE=2 SV=3 794 1107 3.0E-22
sp|P10688|PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus GN=Plcd1 PE=1 SV=1 816 1107 4.0E-22
sp|Q8K2J0|PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus GN=Plcd3 PE=1 SV=2 814 1107 2.0E-21
sp|Q8SPR7|PLCD4_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Sus scrofa GN=PLCD4 PE=2 SV=1 821 1105 4.0E-21
sp|Q8R3B1|PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus GN=Plcd1 PE=1 SV=2 821 1107 1.0E-20
sp|Q944C1|PLCD4_ARATH Phosphoinositide phospholipase C 4 OS=Arabidopsis thaliana GN=PLC4 PE=2 SV=2 561 721 1.0E-20
sp|Q39032|PLCD1_ARATH Phosphoinositide phospholipase C 1 OS=Arabidopsis thaliana GN=PLC1 PE=2 SV=1 497 721 2.0E-20
sp|Q56W08|PLCD3_ARATH Phosphoinositide phospholipase C 3 OS=Arabidopsis thaliana GN=PLC3 PE=2 SV=1 547 721 3.0E-20
sp|Q02158|PLC_DICDI 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Dictyostelium discoideum GN=plc PE=2 SV=1 875 1105 5.0E-20
sp|Q8CIH5|PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus GN=Plcg2 PE=1 SV=1 821 1110 2.0E-19
sp|P24135|PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus GN=Plcg2 PE=1 SV=1 821 1110 4.0E-19
sp|Q4KWH5|PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus GN=Plch1 PE=2 SV=1 796 1055 5.0E-19
sp|P16885|PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens GN=PLCG2 PE=1 SV=4 821 1110 5.0E-19
sp|Q944C2|PLCD5_ARATH Phosphoinositide phospholipase C 5 OS=Arabidopsis thaliana GN=PLC5 PE=2 SV=2 558 721 1.0E-18
sp|Q15111|PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens GN=PLCL1 PE=1 SV=3 758 1107 2.0E-18
sp|Q5RET0|PLCD4_PONAB 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Pongo abelii GN=PLCD4 PE=2 SV=1 821 1105 5.0E-18
sp|Q99P84|PLCE1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Rattus norvegicus GN=Plce1 PE=1 SV=1 846 1102 6.0E-18
sp|Q62711|PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus GN=Plcd4 PE=1 SV=1 821 1093 8.0E-18
sp|Q9BRC7|PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens GN=PLCD4 PE=2 SV=1 821 1105 2.0E-17
sp|Q8K4S1|PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus GN=Plce1 PE=1 SV=3 846 1119 3.0E-17
sp|Q9P212|PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens GN=PLCE1 PE=1 SV=3 846 1102 2.0E-16
sp|A2AP18|PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus GN=Plch2 PE=1 SV=2 872 1055 2.0E-15
sp|Q9STZ3|PLCD8_ARATH Phosphoinositide phospholipase C 8 OS=Arabidopsis thaliana GN=PLC8 PE=2 SV=1 561 718 1.0E-12
sp|Q6NMA7|PLCD9_ARATH Phosphoinositide phospholipase C 9 OS=Arabidopsis thaliana GN=PLC9 PE=2 SV=1 561 718 7.0E-11
sp|Q56W08|PLCD3_ARATH Phosphoinositide phospholipase C 3 OS=Arabidopsis thaliana GN=PLC3 PE=2 SV=1 874 1109 2.0E-07
sp|Q9LY51|PLCD7_ARATH Phosphoinositide phospholipase C 7 OS=Arabidopsis thaliana GN=PLC7 PE=1 SV=1 874 935 2.0E-07
sp|Q39033|PLCD2_ARATH Phosphoinositide phospholipase C 2 OS=Arabidopsis thaliana GN=PLC2 PE=1 SV=1 871 935 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0004435 phosphatidylinositol phospholipase C activity Yes
GO:0007165 signal transduction Yes
GO:0035556 intracellular signal transduction Yes
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0050789 regulation of biological process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0008081 phosphoric diester hydrolase activity No
GO:0003824 catalytic activity No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0004629 phospholipase C activity No
GO:0016298 lipase activity No
GO:0004620 phospholipase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1859
MSGPSYSDKQQMPWSQVLDPSRSSLASQLHRCPRPGRVQTNLCSPPYSPPLHQHPIAVSVSTLSASSVASSSRQG
SPGMSPDAAALLTLNSSIQASPDAIQARDEDHFASTFQLPDCILSRKTSANSISRGCSPVAESVHGSTNGCIPFP
TSTTASACSNNASSAPALGTSTKSGLMRRLSSKASRRITNRRRQSSAAPASRDGSIGPCYLRLRSDSNTTAPPEF
LSALSDSESDFDEREDFVLQSTHLDAVTKGSSANSTTGSIAGSVNNMGGPLMPLQLQRGTQVKKISKKNRSKRVC
LFYEPETNRLTWDRSRPQKFLHVDEIREIRTGSDIQQYARDFNIPQSERPTCFSILYTIPEKSKTKFLHLIADDI
ETCLTWTAFLDAILKHRQEVMTHLMTLNDRAIAQFWQSEMARQFGDQPRKEEAEELDLGGVMRVCQNLHIYSSQS
TLVANFRRCDVRSCERLNFAQFLNFVRLMRQRPDVQRIMRSIAAKPDVGLTLHEFLAFLRNVQEEDVGSNKAMWE
RQFARLVRKQRAEYAEGFDSDQHGAIVMSEAAFVGFLSSRLNGPLVEEPHEYTLDRPMNEYFISSSHNTYLLGRQ
VAGQSSVEGYISALSRGCRCVEVDCWDGSDGQPQVVHGRTLTTAISFKEVMTTINKYAFSKSSFPLWISLEVHCC
AAQQALMVDIMKEAFGSRLVTAPLDATADKLPSPSELMERILIKVKKYGGDCSEVSGRKRGGSLSSPLSRPTVPD
GAALSPLQSPLPQSPLLAGSSQARRLVSKSRVNTITEGEVPELMSSSTSDNESGSEIGPGVKSANKTTKVLGALG
VYCAGVKYYGFDSAPAKTFNHIFSFMEASFAKHSRTKEAKMALDIHNMRYMMRVYPDGIRVGSSNFDPLIYWRRG
VQMAALNWQTFDLGSQLNQAMFEGGKDESGYVLKPPELRDIQVRPFDFAIAQGKKERAVVSFGIDVISAQQLMRP
VNLSANRTMDPYVEIEVFHANDKRDKKEVDSTIVYSHDSPLKFSTEVVRENGFNPLFSSGPFRFKVTTKHPELIF
VRWSVKLASVGDGRDGPPIATFMAKLKNLRNGYRTLPLLNHAGDQYLFSTLFCKIDVDPIETRLFDEPPPPSDVS
KLNRLGGKMFGRGGSSPRSTIEASSLEKMSFDS*
Coding >OphauB2|1859
ATGTCTGGCCCCTCCTACTCTGACAAGCAGCAAATGCCTTGGTCGCAAGTCTTGGACCCCTCGAGGTCCTCTCTT
GCTTCGCAACTGCATCGCTGCCCTCGCCCTGGCCGGGTCCAGACCAATCTTTGCTCGCCGCCATACTCGCCTCCC
CTCCATCAGCACCCCATTGCCGTCTCCGTATCCACCCTCAGCGCCTCGTCTGTCGCCTCGAGCTCGCGCCAGGGT
TCTCCCGGCATGTCTCCCGATGCTGCAGCTCTCTTGACTCTGAATTCGTCGATTCAGGCCTCGCCCGACGCAATT
CAAGCTCGTGATGAAGACCACTTTGCCTCGACTTTCCAGCTCCCAGACTGTATTTTGTCGCGCAAGACAAGCGCA
AACTCAATCTCTCGCGGCTGCAGCCCCGTTGCCGAGAGTGTCCACGGCAGCACCAATGGCTGCATCCCCTTCCCT
ACCAGTACCACTGCATCGGCCTGCAGCAACAATGCTAGTAGCGCCCCGGCCCTCGGCACGTCAACCAAGAGTGGC
TTGATGCGCCGCCTTTCCAGCAAGGCTTCTCGCCGCATCACCAATCGCAGGCGTCAATCCTCGGCTGCACCTGCA
AGCCGCGACGGCAGCATCGGTCCCTGCTACCTGCGTCTGCGCAGCGATAGCAATACCACTGCTCCGCCAGAATTC
TTGTCTGCCCTAAGCGACTCGGAATCCGACTTTGACGAGCGCGAAGACTTTGTCTTGCAGTCGACCCACTTGGAC
GCCGTCACCAAGGGCTCCTCAGCCAACAGCACCACGGGGTCAATTGCCGGCAGCGTTAACAACATGGGCGGCCCT
CTGATGCCCTTGCAGCTGCAGCGAGGCACCCAAGTCAAGAAGATTTCAAAAAAGAACCGCTCCAAGCGTGTTTGC
CTCTTTTACGAGCCCGAGACAAATAGGCTCACCTGGGACAGGTCTCGTCCGCAAAAATTTCTCCATGTCGATGAG
ATTAGAGAAATTCGCACGGGCTCCGACATTCAGCAGTATGCTCGCGACTTCAACATTCCACAGTCGGAGCGCCCC
ACCTGCTTCTCCATTCTCTACACCATTCCAGAAAAGTCAAAGACCAAGTTCTTGCACCTCATTGCCGACGACATT
GAGACTTGTTTGACTTGGACTGCCTTTTTGGATGCCATTCTCAAGCATCGCCAAGAGGTCATGACGCACCTCATG
ACGCTCAATGACCGCGCCATTGCCCAGTTTTGGCAGAGCGAAATGGCGAGACAGTTTGGAGACCAGCCCCGCAAG
GAGGAGGCCGAGGAGCTTGACTTGGGAGGCGTGATGCGAGTCTGCCAAAACTTGCACATTTACAGCTCACAGTCT
ACGCTGGTGGCCAATTTTCGGCGCTGCGATGTGAGGTCGTGCGAGCGGCTCAACTTTGCCCAGTTTCTCAATTTT
GTCCGCCTCATGAGACAGAGACCAGATGTGCAGCGCATTATGCGGAGCATTGCCGCCAAGCCCGATGTCGGCCTG
ACTCTACACGAGTTTTTGGCCTTTTTGCGCAATGTACAGGAAGAAGATGTTGGCTCCAACAAGGCCATGTGGGAG
AGGCAGTTTGCCCGTCTGGTGCGCAAGCAGCGGGCAGAGTATGCTGAAGGCTTTGACTCGGACCAGCATGGTGCC
ATTGTCATGTCTGAAGCTGCCTTTGTGGGCTTTTTGTCTTCGCGCCTCAATGGTCCCTTGGTTGAGGAGCCGCAC
GAGTACACACTTGACCGTCCAATGAATGAATACTTCATCTCAAGTTCTCACAATACATATCTGCTCGGCCGCCAA
GTGGCTGGCCAGTCGAGTGTCGAGGGCTACATTTCGGCCTTGTCCCGCGGCTGCCGGTGTGTCGAGGTGGATTGC
TGGGATGGATCAGATGGACAGCCACAGGTGGTGCACGGCCGGACGCTTACCACTGCAATTAGCTTCAAGGAAGTC
ATGACAACCATTAACAAGTATGCCTTTTCCAAGTCGAGTTTTCCCCTCTGGATCTCACTAGAAGTCCACTGCTGC
GCCGCCCAGCAGGCCTTGATGGTGGATATCATGAAGGAGGCGTTTGGGTCGCGACTGGTGACTGCACCGCTGGAT
GCCACGGCGGACAAGCTGCCCTCGCCATCGGAGCTGATGGAGCGCATCCTCATCAAGGTGAAGAAGTATGGCGGC
GATTGCTCCGAAGTGTCTGGCCGCAAGCGCGGCGGGAGCCTGAGCTCGCCACTTTCGAGGCCAACGGTGCCTGAT
GGTGCTGCCCTTTCCCCCCTGCAGTCTCCTCTGCCCCAGAGCCCGCTGTTGGCTGGCAGCAGCCAGGCGAGGCGG
CTTGTCAGCAAGAGTCGGGTCAATACGATTACCGAGGGCGAGGTGCCAGAGCTCATGAGCAGCAGCACCAGCGAC
AATGAGAGTGGCAGCGAGATTGGCCCGGGTGTCAAGTCGGCCAACAAGACGACCAAGGTGCTTGGTGCACTTGGC
GTCTATTGCGCTGGCGTCAAGTATTATGGCTTCGATTCTGCTCCGGCCAAGACTTTTAATCACATCTTTTCCTTT
ATGGAGGCTAGCTTTGCCAAGCACTCTCGAACAAAGGAGGCCAAGATGGCGCTCGACATTCACAATATGCGCTAC
ATGATGCGCGTGTATCCCGACGGGATCCGTGTCGGCTCAAGCAACTTTGATCCACTCATTTACTGGCGCAGAGGC
GTCCAGATGGCGGCTCTCAATTGGCAGACGTTTGATTTGGGCTCGCAGCTCAATCAGGCCATGTTTGAGGGCGGC
AAGGATGAGTCGGGATATGTGCTTAAACCTCCCGAGTTGCGCGACATTCAGGTTCGGCCCTTTGACTTTGCCATT
GCCCAGGGCAAAAAGGAGCGCGCCGTTGTATCCTTTGGCATCGACGTCATTTCTGCCCAGCAGTTGATGCGCCCC
GTCAATCTTTCAGCCAATAGGACAATGGATCCCTATGTCGAGATTGAAGTGTTTCACGCCAATGACAAGCGTGAC
AAGAAGGAAGTCGACTCTACCATTGTCTATAGCCACGACTCGCCTCTCAAGTTTTCGACCGAGGTTGTGCGGGAA
AATGGCTTCAACCCCCTCTTTTCGAGCGGGCCATTTCGCTTCAAGGTGACGACGAAGCACCCAGAGCTCATTTTT
GTGCGCTGGTCGGTCAAGCTGGCTAGCGTTGGCGATGGCAGAGATGGTCCGCCCATTGCAACCTTTATGGCCAAG
CTGAAGAATTTACGCAATGGATACCGCACGCTGCCTCTGCTCAATCATGCGGGAGACCAGTACCTCTTTTCGACG
CTCTTTTGCAAGATTGACGTGGACCCGATTGAGACGAGGCTTTTTGACGAGCCGCCTCCCCCCTCTGACGTGAGC
AAGCTGAACCGGCTGGGCGGCAAGATGTTTGGCCGCGGTGGCTCGAGTCCTCGCAGCACCATTGAAGCAAGCAGC
CTGGAAAAGATGAGCTTTGACAGCTAA
Transcript >OphauB2|1859
ATGTCTGGCCCCTCCTACTCTGACAAGCAGCAAATGCCTTGGTCGCAAGTCTTGGACCCCTCGAGGTCCTCTCTT
GCTTCGCAACTGCATCGCTGCCCTCGCCCTGGCCGGGTCCAGACCAATCTTTGCTCGCCGCCATACTCGCCTCCC
CTCCATCAGCACCCCATTGCCGTCTCCGTATCCACCCTCAGCGCCTCGTCTGTCGCCTCGAGCTCGCGCCAGGGT
TCTCCCGGCATGTCTCCCGATGCTGCAGCTCTCTTGACTCTGAATTCGTCGATTCAGGCCTCGCCCGACGCAATT
CAAGCTCGTGATGAAGACCACTTTGCCTCGACTTTCCAGCTCCCAGACTGTATTTTGTCGCGCAAGACAAGCGCA
AACTCAATCTCTCGCGGCTGCAGCCCCGTTGCCGAGAGTGTCCACGGCAGCACCAATGGCTGCATCCCCTTCCCT
ACCAGTACCACTGCATCGGCCTGCAGCAACAATGCTAGTAGCGCCCCGGCCCTCGGCACGTCAACCAAGAGTGGC
TTGATGCGCCGCCTTTCCAGCAAGGCTTCTCGCCGCATCACCAATCGCAGGCGTCAATCCTCGGCTGCACCTGCA
AGCCGCGACGGCAGCATCGGTCCCTGCTACCTGCGTCTGCGCAGCGATAGCAATACCACTGCTCCGCCAGAATTC
TTGTCTGCCCTAAGCGACTCGGAATCCGACTTTGACGAGCGCGAAGACTTTGTCTTGCAGTCGACCCACTTGGAC
GCCGTCACCAAGGGCTCCTCAGCCAACAGCACCACGGGGTCAATTGCCGGCAGCGTTAACAACATGGGCGGCCCT
CTGATGCCCTTGCAGCTGCAGCGAGGCACCCAAGTCAAGAAGATTTCAAAAAAGAACCGCTCCAAGCGTGTTTGC
CTCTTTTACGAGCCCGAGACAAATAGGCTCACCTGGGACAGGTCTCGTCCGCAAAAATTTCTCCATGTCGATGAG
ATTAGAGAAATTCGCACGGGCTCCGACATTCAGCAGTATGCTCGCGACTTCAACATTCCACAGTCGGAGCGCCCC
ACCTGCTTCTCCATTCTCTACACCATTCCAGAAAAGTCAAAGACCAAGTTCTTGCACCTCATTGCCGACGACATT
GAGACTTGTTTGACTTGGACTGCCTTTTTGGATGCCATTCTCAAGCATCGCCAAGAGGTCATGACGCACCTCATG
ACGCTCAATGACCGCGCCATTGCCCAGTTTTGGCAGAGCGAAATGGCGAGACAGTTTGGAGACCAGCCCCGCAAG
GAGGAGGCCGAGGAGCTTGACTTGGGAGGCGTGATGCGAGTCTGCCAAAACTTGCACATTTACAGCTCACAGTCT
ACGCTGGTGGCCAATTTTCGGCGCTGCGATGTGAGGTCGTGCGAGCGGCTCAACTTTGCCCAGTTTCTCAATTTT
GTCCGCCTCATGAGACAGAGACCAGATGTGCAGCGCATTATGCGGAGCATTGCCGCCAAGCCCGATGTCGGCCTG
ACTCTACACGAGTTTTTGGCCTTTTTGCGCAATGTACAGGAAGAAGATGTTGGCTCCAACAAGGCCATGTGGGAG
AGGCAGTTTGCCCGTCTGGTGCGCAAGCAGCGGGCAGAGTATGCTGAAGGCTTTGACTCGGACCAGCATGGTGCC
ATTGTCATGTCTGAAGCTGCCTTTGTGGGCTTTTTGTCTTCGCGCCTCAATGGTCCCTTGGTTGAGGAGCCGCAC
GAGTACACACTTGACCGTCCAATGAATGAATACTTCATCTCAAGTTCTCACAATACATATCTGCTCGGCCGCCAA
GTGGCTGGCCAGTCGAGTGTCGAGGGCTACATTTCGGCCTTGTCCCGCGGCTGCCGGTGTGTCGAGGTGGATTGC
TGGGATGGATCAGATGGACAGCCACAGGTGGTGCACGGCCGGACGCTTACCACTGCAATTAGCTTCAAGGAAGTC
ATGACAACCATTAACAAGTATGCCTTTTCCAAGTCGAGTTTTCCCCTCTGGATCTCACTAGAAGTCCACTGCTGC
GCCGCCCAGCAGGCCTTGATGGTGGATATCATGAAGGAGGCGTTTGGGTCGCGACTGGTGACTGCACCGCTGGAT
GCCACGGCGGACAAGCTGCCCTCGCCATCGGAGCTGATGGAGCGCATCCTCATCAAGGTGAAGAAGTATGGCGGC
GATTGCTCCGAAGTGTCTGGCCGCAAGCGCGGCGGGAGCCTGAGCTCGCCACTTTCGAGGCCAACGGTGCCTGAT
GGTGCTGCCCTTTCCCCCCTGCAGTCTCCTCTGCCCCAGAGCCCGCTGTTGGCTGGCAGCAGCCAGGCGAGGCGG
CTTGTCAGCAAGAGTCGGGTCAATACGATTACCGAGGGCGAGGTGCCAGAGCTCATGAGCAGCAGCACCAGCGAC
AATGAGAGTGGCAGCGAGATTGGCCCGGGTGTCAAGTCGGCCAACAAGACGACCAAGGTGCTTGGTGCACTTGGC
GTCTATTGCGCTGGCGTCAAGTATTATGGCTTCGATTCTGCTCCGGCCAAGACTTTTAATCACATCTTTTCCTTT
ATGGAGGCTAGCTTTGCCAAGCACTCTCGAACAAAGGAGGCCAAGATGGCGCTCGACATTCACAATATGCGCTAC
ATGATGCGCGTGTATCCCGACGGGATCCGTGTCGGCTCAAGCAACTTTGATCCACTCATTTACTGGCGCAGAGGC
GTCCAGATGGCGGCTCTCAATTGGCAGACGTTTGATTTGGGCTCGCAGCTCAATCAGGCCATGTTTGAGGGCGGC
AAGGATGAGTCGGGATATGTGCTTAAACCTCCCGAGTTGCGCGACATTCAGGTTCGGCCCTTTGACTTTGCCATT
GCCCAGGGCAAAAAGGAGCGCGCCGTTGTATCCTTTGGCATCGACGTCATTTCTGCCCAGCAGTTGATGCGCCCC
GTCAATCTTTCAGCCAATAGGACAATGGATCCCTATGTCGAGATTGAAGTGTTTCACGCCAATGACAAGCGTGAC
AAGAAGGAAGTCGACTCTACCATTGTCTATAGCCACGACTCGCCTCTCAAGTTTTCGACCGAGGTTGTGCGGGAA
AATGGCTTCAACCCCCTCTTTTCGAGCGGGCCATTTCGCTTCAAGGTGACGACGAAGCACCCAGAGCTCATTTTT
GTGCGCTGGTCGGTCAAGCTGGCTAGCGTTGGCGATGGCAGAGATGGTCCGCCCATTGCAACCTTTATGGCCAAG
CTGAAGAATTTACGCAATGGATACCGCACGCTGCCTCTGCTCAATCATGCGGGAGACCAGTACCTCTTTTCGACG
CTCTTTTGCAAGATTGACGTGGACCCGATTGAGACGAGGCTTTTTGACGAGCCGCCTCCCCCCTCTGACGTGAGC
AAGCTGAACCGGCTGGGCGGCAAGATGTTTGGCCGCGGTGGCTCGAGTCCTCGCAGCACCATTGAAGCAAGCAGC
CTGGAAAAGATGAGCTTTGACAGCTAA
Gene >OphauB2|1859
ATGTCTGGCCCCTCCTACTCTGACAAGCAGCAAATGCCTTGGTCGCAAGTCTTGGACCCCTCGAGGTCCTCTCTT
GCTTCGCAACTGCATCGCTGCCCTCGCCCTGGCCGGGTCCAGACCAATCTTTGCTCGCCGCCATACTCGCCTCCC
CTCCATCAGCACCCCATTGCCGTCTCCGTATCCACCCTCAGCGCCTCGTCTGTCGCCTCGAGCTCGCGCCAGGGT
TCTCCCGGCATGTCTCCCGATGCTGCAGCTCTCTTGACTCTGAATTCGTCGATTCAGGCCTCGCCCGACGCAATT
CAAGCTCGTGATGAAGACCACTTTGCCTCGACTTTCCAGCTCCCAGACTGTATTTTGTCGCGCAAGACAAGCGCA
AACTCAATCTCTCGCGGCTGCAGCCCCGTTGCCGAGAGTGTCCACGGCAGCACCAATGGCTGCATCCCCTTCCCT
ACCAGTACCACTGCATCGGCCTGCAGCAACAATGCTAGTAGCGCCCCGGCCCTCGGCACGTCAACCAAGAGTGGC
TTGATGCGCCGCCTTTCCAGCAAGGCTTCTCGCCGCATCACCAATCGCAGGCGTCAATCCTCGGCTGCACCTGCA
AGCCGCGACGGCAGCATCGGTCCCTGCTACCTGCGTCTGCGCAGCGATAGCAATACCACTGCTCCGCCAGAATTC
TTGTCTGCCCTAAGCGACTCGGAATCCGACTTTGACGAGCGCGAAGACTTTGTCTTGCAGTCGACCCACTTGGAC
GCCGTCACCAAGGGCTCCTCAGCCAACAGCACCACGGGGTCAATTGCCGGCAGCGTTAACAACATGGGCGGCCCT
CTGATGCCCTTGCAGCTGCAGCGAGGCACCCAAGTCAAGAAGATTTCAAAAAAGAACCGCTCCAAGCGTGTTTGC
CTCTTTTACGAGCCCGAGACAAATAGGCTCACCTGGGACAGGTCTCGTCCGCAAAAATTTCTCCATGTCGATGAG
ATTAGAGAAATTCGCACGGGCTCCGACATTCAGCAGTATGCTCGCGACTTCAACATTCCACAGTCGGAGCGCCCC
ACCTGCTTCTCCATTCTCTACACCATTCCAGAAAAGTCAAAGACCAAGTTCTTGCACCTCATTGCCGACGACATT
GAGACTTGTTTGACTTGGACTGCCTTTTTGGATGCCATTCTCAAGCATCGCCAAGAGGTCATGACGCACCTCATG
ACGCTCAATGACCGCGCCATTGCCCAGTTTTGGCAGAGCGAAATGGCGAGACAGTTTGGAGACCAGCCCCGCAAG
GAGGAGGCCGAGGAGCTTGACTTGGGAGGCGTGATGCGAGTCTGCCAAAACTTGCACATTTACAGCTCACAGTCT
ACGCTGGTGGCCAATTTTCGGCGCTGCGATGTGAGGTCGTGCGAGCGGCTCAACTTTGCCCAGTTTCTCAATTTT
GTCCGCCTCATGAGACAGAGACCAGATGTGCAGCGCATTATGCGGAGCATTGCCGCCAAGCCCGATGTCGGCCTG
ACTCTACACGAGTTTTTGGCCTTTTTGCGCAATGTACAGGAAGAAGATGTTGGCTCCAACAAGGCCATGTGGGAG
AGGCAGTTTGCCCGTCTGGTGCGCAAGCAGCGGGCAGAGTATGCTGAAGGCTTTGACTCGGACCAGCATGGTGCC
ATTGTCATGTCTGAAGCTGCCTTTGTGGGCTTTTTGTCTTCGCGCCTCAATGGTCCCTTGGTTGAGGAGCCGCAC
GAGTACACACTTGACCGTCCAATGAATGAATACTTCATCTCAAGTTCTCACAATACATATCTGCTCGGCCGCCAA
GTGGCTGGCCAGTCGAGTGTCGAGGGCTACATTTCGGCCTTGTCCCGCGGCTGCCGGTGTGTCGAGGTGGATTGC
TGGGATGGATCAGATGGACAGCCACAGGTGGTGCACGGCCGGACGCTTACCACTGCAATTAGCTTCAAGGAAGTC
ATGACAACCATTAACAAGTATGCCTTTTCCAAGTCGAGTTTTCCCCTCTGGATCTCACTAGAAGTCCACTGCTGC
GCCGCCCAGCAGGCCTTGATGGTGGATATCATGAAGGAGGCGTTTGGGTCGCGACTGGTGACTGCACCGCTGGAT
GCCACGGCGGACAAGCTGCCCTCGCCATCGGAGCTGATGGAGCGCATCCTCATCAAGGTGAAGAAGTATGGCGGC
GATTGCTCCGAAGTGTCTGGCCGCAAGCGCGGCGGGAGCCTGAGCTCGCCACTTTCGAGGCCAACGGTGCCTGAT
GGTGCTGCCCTTTCCCCCCTGCAGTCTCCTCTGCCCCAGAGCCCGCTGTTGGCTGGCAGCAGCCAGGCGAGGCGG
CTTGTCAGCAAGAGTCGGGTCAATACGATTACCGAGGGCGAGGTGCCAGAGCTCATGAGCAGCAGCACCAGCGAC
AATGAGAGTGGCAGCGAGATTGGCCCGGGTGTCAAGTCGGCCAACAAGACGACCAAGGTGCTTGGTGCACTTGGC
GTCTATTGCGCTGGCGTCAAGTATTATGGCTTCGATTCTGCTCCGGCCAAGACTTTTAATCACATCTTTTCCTTT
ATGGAGGCTAGCTTTGCCAAGCACTCTCGAACAAAGGAGGCCAAGATGGCGCTCGACATTCACAATATGCGCTAC
ATGATGCGCGTGTATCCCGACGGGATCCGTGTCGGCTCAAGCAACTTTGATCCACTCATTTACTGGCGCAGAGGC
GTCCAGATGGCGGCTCTCAATTGGCAGACGTTTGATTTGGGCTCGCAGCTCAATCAGGCCATGTTTGAGGGCGGC
AAGGATGAGTCGGGATATGTGCTTAAACCTCCCGAGTTGCGCGACATTCAGGTTCGGCCCTTTGACTTTGCCATT
GCCCAGGGCAAAAAGGAGCGCGCCGTTGTATCCTTTGGCATCGACGTCATTTCTGCCCAGCAGTTGATGCGCCCC
GTCAATCTTTCAGCCAATAGGACAATGGATCCCTATGTCGAGATTGAAGTGTTTCACGCCAATGACAAGCGTGAC
AAGAAGGAAGTCGACTCTACCATTGTCTATAGCCACGACTCGCCTCTCAAGTTTTCGACCGAGGTTGTGCGGGAA
AATGGCTTCAACCCCCTCTTTTCGAGCGGGCCATTTCGCTTCAAGGTGACGACGAAGCACCCAGAGCTCATTTTT
GTGCGCTGGTCGGTCAAGCTGGCTAGCGTTGGCGATGGCAGAGATGGTCCGCCCATTGCAACCTTTATGGCCAAG
CTGAAGAATTTACGCAATGGATACCGCACGCTGCCTCTGCTCAATCATGCGGGAGACCAGTACCTCTTTTCGACG
CTCTTTTGCAAGATTGACGTGGACCCGATTGAGACGAGGCTTTTTGACGAGCCGCCTCCCCCCTCTGACGTGAGC
AAGCTGAACCGGCTGGGCGGCAAGATGTTTGGCCGCGGTGGCTCGAGTCCTCGCAGCACCATTGAAGCAAGCAGC
CTGGAAAAGATGAGCTTTGACAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail