Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1853
Gene name
LocationContig_152:38407..40208
Strand+
Gene length (bp)1801
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00855 PWWP PWWP domain 6.9E-15 76 182

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09842|PDP3_SCHPO PWWP domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp3 PE=1 SV=1 74 414 1.0E-07
sp|O59676|PDP1_SCHPO PWWP domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp1 PE=1 SV=1 327 419 2.0E-07
sp|O94312|PDP2_SCHPO PWWP domain-containing protein2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp2 PE=1 SV=1 37 158 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1853
MKDEPVSAAGENEAPSKAEPQDAAPAAAAAPAPAEAPTANKGKNARRKSVASESKAKGLTKKASKTRLTHLDAKP
GDHFLVKLKGFPAWPAIICDESMLPAALINTRPVSAARPDGSYAEAYAQGGKRTYDRTFPVMYLYTNEFGWVQNT
MLSELTAEKAKDSVTDKMRKDLRAAFELAAEHHAVDHYKQILENFEQEQIAQEEAKKQAAATPKKSKKAKTKATE
DDDDVEMEDADAPPKSAKSKKRKADETNTPQRSDSVKKPKIKLNTSSTPKAANGAATPKSGGGAASKTKSKPKKS
KDGADKKADTAKEPSLDPEVRHARKEKEVLYLRHKLQRGLLTREQQPREEEMKTMSDFISMLENFKDLEVSIIRI
TKINKVLKAILKLESIPRESEFEFKKRSQKLLDKWNKLLAGEPSAPPSASTNGINGSAGDDSKSDKNGVKSESDE
QEKGPAETDKSQEDQKIPETMTRDEPANKTNESNQADDEAKTADKADAATEPIKSEV*
Coding >OphauB2|1853
ATGAAGGACGAGCCCGTCAGCGCGGCCGGCGAGAATGAAGCACCATCCAAGGCGGAGCCCCAGGATGCTGCCCCC
GCTGCTGCTGCTGCCCCTGCCCCTGCTGAGGCTCCCACTGCCAACAAGGGCAAGAATGCCCGCCGCAAATCCGTT
GCCAGCGAATCCAAGGCCAAGGGCTTGACCAAGAAGGCGAGCAAGACGCGTCTTACCCATCTAGACGCAAAGCCC
GGCGACCACTTTCTCGTCAAGCTCAAGGGCTTTCCGGCGTGGCCGGCCATTATATGCGACGAGAGTATGCTCCCG
GCGGCTCTCATCAACACGCGTCCAGTCTCTGCTGCCCGGCCAGATGGAAGCTACGCTGAAGCCTATGCCCAAGGA
GGCAAGCGGACATATGACAGAACGTTTCCTGTCATGTACCTGTACACGAATGAATTTGGATGGGTTCAAAACACC
ATGCTCTCGGAGCTCACGGCGGAAAAGGCCAAGGACAGCGTCACCGACAAGATGCGAAAGGACCTCAGGGCGGCG
TTTGAGCTTGCTGCCGAGCATCACGCCGTAGACCATTACAAGCAGATTCTCGAAAACTTTGAGCAAGAGCAAATT
GCGCAGGAAGAGGCCAAGAAGCAGGCCGCCGCCACACCCAAAAAGTCCAAAAAGGCCAAGACCAAGGCGACAGAG
GATGACGACGACGTGGAAATGGAGGATGCTGACGCCCCCCCCAAATCGGCCAAGTCTAAGAAGCGCAAAGCCGAC
GAAACAAATACACCACAACGCTCCGACTCGGTCAAGAAGCCCAAGATCAAGCTCAACACGTCTTCGACTCCAAAA
GCAGCCAACGGCGCTGCAACACCCAAGTCTGGGGGTGGCGCTGCCTCCAAGACTAAATCCAAGCCCAAAAAATCC
AAGGATGGAGCGGACAAGAAGGCTGACACGGCCAAGGAGCCCAGCTTGGATCCAGAAGTTCGCCATGCTCGCAAA
GAGAAAGAAGTACTCTACCTACGACACAAGCTTCAACGTGGACTCCTTACTCGGGAGCAGCAGCCTCGGGAGGAA
GAGATGAAGACAATGTCGGATTTTATCAGCATGCTCGAAAACTTTAAGGATCTCGAGGTGTCGATAATTCGAATC
ACCAAGATCAACAAGGTGCTCAAGGCCATTCTCAAGCTCGAGTCGATTCCCCGTGAGTCGGAATTCGAGTTCAAG
AAGCGCTCACAGAAGCTGCTTGACAAGTGGAACAAGCTGCTTGCTGGTGAGCCATCGGCACCGCCGTCGGCCTCT
ACGAATGGCATCAATGGCTCAGCTGGTGATGACAGCAAGTCGGACAAGAATGGCGTCAAGAGCGAGAGTGATGAG
CAGGAAAAGGGCCCGGCTGAGACGGACAAATCTCAGGAGGACCAGAAAATACCTGAGACGATGACGCGGGATGAG
CCGGCCAACAAGACGAATGAATCCAACCAAGCAGATGACGAGGCAAAGACGGCTGACAAGGCGGACGCTGCAACG
GAGCCCATCAAAAGCGAAGTCTGA
Transcript >OphauB2|1853
ATGAAGGACGAGCCCGTCAGCGCGGCCGGCGAGAATGAAGCACCATCCAAGGCGGAGCCCCAGGATGCTGCCCCC
GCTGCTGCTGCTGCCCCTGCCCCTGCTGAGGCTCCCACTGCCAACAAGGGCAAGAATGCCCGCCGCAAATCCGTT
GCCAGCGAATCCAAGGCCAAGGGCTTGACCAAGAAGGCGAGCAAGACGCGTCTTACCCATCTAGACGCAAAGCCC
GGCGACCACTTTCTCGTCAAGCTCAAGGGCTTTCCGGCGTGGCCGGCCATTATATGCGACGAGAGTATGCTCCCG
GCGGCTCTCATCAACACGCGTCCAGTCTCTGCTGCCCGGCCAGATGGAAGCTACGCTGAAGCCTATGCCCAAGGA
GGCAAGCGGACATATGACAGAACGTTTCCTGTCATGTACCTGTACACGAATGAATTTGGATGGGTTCAAAACACC
ATGCTCTCGGAGCTCACGGCGGAAAAGGCCAAGGACAGCGTCACCGACAAGATGCGAAAGGACCTCAGGGCGGCG
TTTGAGCTTGCTGCCGAGCATCACGCCGTAGACCATTACAAGCAGATTCTCGAAAACTTTGAGCAAGAGCAAATT
GCGCAGGAAGAGGCCAAGAAGCAGGCCGCCGCCACACCCAAAAAGTCCAAAAAGGCCAAGACCAAGGCGACAGAG
GATGACGACGACGTGGAAATGGAGGATGCTGACGCCCCCCCCAAATCGGCCAAGTCTAAGAAGCGCAAAGCCGAC
GAAACAAATACACCACAACGCTCCGACTCGGTCAAGAAGCCCAAGATCAAGCTCAACACGTCTTCGACTCCAAAA
GCAGCCAACGGCGCTGCAACACCCAAGTCTGGGGGTGGCGCTGCCTCCAAGACTAAATCCAAGCCCAAAAAATCC
AAGGATGGAGCGGACAAGAAGGCTGACACGGCCAAGGAGCCCAGCTTGGATCCAGAAGTTCGCCATGCTCGCAAA
GAGAAAGAAGTACTCTACCTACGACACAAGCTTCAACGTGGACTCCTTACTCGGGAGCAGCAGCCTCGGGAGGAA
GAGATGAAGACAATGTCGGATTTTATCAGCATGCTCGAAAACTTTAAGGATCTCGAGGTGTCGATAATTCGAATC
ACCAAGATCAACAAGGTGCTCAAGGCCATTCTCAAGCTCGAGTCGATTCCCCGTGAGTCGGAATTCGAGTTCAAG
AAGCGCTCACAGAAGCTGCTTGACAAGTGGAACAAGCTGCTTGCTGGTGAGCCATCGGCACCGCCGTCGGCCTCT
ACGAATGGCATCAATGGCTCAGCTGGTGATGACAGCAAGTCGGACAAGAATGGCGTCAAGAGCGAGAGTGATGAG
CAGGAAAAGGGCCCGGCTGAGACGGACAAATCTCAGGAGGACCAGAAAATACCTGAGACGATGACGCGGGATGAG
CCGGCCAACAAGACGAATGAATCCAACCAAGCAGATGACGAGGCAAAGACGGCTGACAAGGCGGACGCTGCAACG
GAGCCCATCAAAAGCGAAGTCTGA
Gene >OphauB2|1853
ATGAAGGACGAGCCCGTCAGCGCGGCCGGCGAGAATGAAGCACCATCCAAGGCGGAGCCCCAGGATGCTGCCCCC
GCTGCTGCTGCTGCCCCTGCCCCTGCTGAGGCTCCCACTGCCAACAAGGGCAAGAATGCCCGCCGCAAATCCGTT
GCCAGCGAATCCAAGGCCAAGGGCTTGACCAAGAAGGCGAGCAAGACGCGTCTTACCCATCTAGACGCAAAGCCC
GGCGACCACTTTCTCGTCAAGCTCAAGGGCTTTCCGGCGTGGCCGGCCATTATATGCGACGAGAGTATGCTCCCG
GCGGCTCTCATCAACACGCGTCCAGTCTCTGCTGCCCGGCCAGATGGAAGCTACGCTGAAGCCTATGCCCAAGGA
GGCAAGCGGACATATGACAGAACGTTTCCTGTCATGTACCTGTACACGAATGAATTGTAAGCCCCCTGACGGATG
CCACCATGCCCGTGTGTTCAAGCTACAAGCTTCTAAGACGCAATTTTAGTGGATGGGTTCAAAACACCATGCTCT
CGGAGCTCACGGCGGAAAAGGCCAAGGACAGCGTCACCGACAAGATGCGAAAGGACCTCAGGGCGGCGTTTGAGC
TTGCTGCCGAGCATCACGCCGTAGACCATTACAAGCAGATTCTCGAAAACTTTGAGCAAGAGCAAATTGCGCAGG
AAGAGGCCAAGAAGCAGGCCGCCGCCACACCCAAAAAGTCCAAAAAGGCCAAGACCAAGGCGACAGAGGATGACG
ACGACGTGGAAATGGAGGATGCTGACGCCCCCCCCAAATCGGCCAAGTCTAAGAAGCGCAAAGCCGACGAAACAA
ATGTAAGAAACATGGAGCTTGTTATGCGGCATTCATCAAGCAAGACTTGCTGACTCTTCTTCCTCTTCTTTTTCT
CTCTTGCTCCACCGTGCCAGACACCACAACGCTCCGACTCGGTCAAGAAGCCCAAGATCAAGCTCAACACGTCTT
CGACTCCAAAAGCAGCCAACGGCGCTGCAACACCCAAGTCTGGGGGTGGCGCTGCCTCCAAGACTAAATCCAAGC
CCAAAAAATCCAAGGATGGAGCGGACAAGAAGGCTGACACGGCCAAGGAGCCCAGCTTGGATCCAGAAGTTCGCC
ATGCTCGCAAAGAGGTGAGCAAGAGCCAAAGCATGACTTGACGGGCGGCGCTGACGTTGGAAGCAGAAAGAAGTA
CTCTACCTACGACACAAGCTTCAACGTGGACTCCTTACTCGGGAGCAGCAGCCTCGGGAGGAAGAGATGAAGACA
ATGTCGGATTTTATCAGCATGCTCGAAAACTTTAAGGATCTCGAGGTGTCGATAATTCGAATCACCAAGATCAAC
AAGGTGCTCAAGGCCATTCTCAAGCTCGAGTCGATTCCCCGTGAGTCGGAATTCGAGTTCAAGAAGCGCTCACAG
AAGCTGCTTGACAAGTGGAACAAGCTGCTTGCTGGTGAGCCATCGGCACCGCCGTCGGCCTCTACGAATGGCATC
AATGGCTCAGCTGGTGATGACAGCAAGTCGGACAAGAATGGCGTCAAGAGCGAGAGTGATGAGCAGGAAAAGGGC
CCGGCTGAGACGGACAAATCTCAGGAGGACCAGAAAATACCTGAGACGATGACGCGGGATGAGCCGGCCAACAAG
ACGAATGAATCCAACCAAGCAGATGACGAGGCAAAGACGGCTGACAAGGCGGTGGGTGCAGCAGGAGTCATGCAC
GAGCCAAAGGTGTGAGCATTGGAGCTGACAAGACGCCCAGGACGCTGCAACGGAGCCCATCAAAAGCGAAGTCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail