Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1852
Gene name
LocationContig_152:30519..37211
Strand+
Gene length (bp)6692
Transcript length (bp)6594
Coding sequence length (bp)6594
Protein length (aa) 2198

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02889 Sec63 Sec63 Brl domain 3.9E-89 1021 1326
PF02889 Sec63 Sec63 Brl domain 1.2E-65 1856 2179
PF00270 DEAD DEAD/DEAH box helicase 5.0E-29 521 696
PF00270 DEAD DEAD/DEAH box helicase 2.7E-17 1372 1534
PF18149 Helicase_PWI N-terminal helicase PWI domain 4.1E-32 289 402
PF04851 ResIII Type III restriction enzyme, res subunit 2.8E-13 520 695
PF00271 Helicase_C Helicase conserved C-terminal domain 5.5E-07 758 899

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 4 2197 0.0E+00
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 1 2194 0.0E+00
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 1 2194 0.0E+00
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 1 2194 0.0E+00
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 1 2185 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 4 2197 0.0E+00
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 1 2194 0.0E+00
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 1 2194 0.0E+00
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 1 2194 0.0E+00
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 1 2185 0.0E+00
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 2 2181 0.0E+00
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 1 2181 0.0E+00
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 8 2181 0.0E+00
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 1 2185 0.0E+00
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 11 2183 0.0E+00
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 290 2186 0.0E+00
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 337 2176 0.0E+00
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 337 2176 0.0E+00
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 337 2186 0.0E+00
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 461 2194 0.0E+00
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 466 2196 0.0E+00
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 461 2186 0.0E+00
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 465 2170 0.0E+00
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 469 2016 0.0E+00
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 465 2139 0.0E+00
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 498 1163 3.0E-93
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 498 1174 4.0E-93
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 498 1282 1.0E-88
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 498 1163 3.0E-87
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 492 1171 1.0E-86
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 489 1163 1.0E-79
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 1329 1922 4.0E-65
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 1358 1921 1.0E-60
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 1362 2013 1.0E-60
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 1366 2007 1.0E-58
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 1367 1978 1.0E-57
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 1370 1915 2.0E-53
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 523 918 8.0E-44
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 517 937 3.0E-43
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 523 916 4.0E-43
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 531 1033 6.0E-43
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 517 937 7.0E-43
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 529 916 1.0E-42
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 517 937 1.0E-41
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 536 911 2.0E-41
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 536 1033 6.0E-41
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 536 1090 1.0E-40
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 504 914 2.0E-40
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 517 937 1.0E-39
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 517 1033 1.0E-39
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 523 939 2.0E-39
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 536 1033 1.0E-38
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 536 966 2.0E-38
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 536 964 3.0E-38
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 536 964 3.0E-38
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 517 1091 5.0E-38
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 536 1000 3.0E-37
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 531 921 4.0E-37
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 536 911 6.0E-37
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 517 974 9.0E-36
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 536 1033 5.0E-35
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 536 966 3.0E-34
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 517 937 1.0E-33
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 536 966 1.0E-33
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 459 992 1.0E-30
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 422 929 2.0E-30
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 536 970 3.0E-30
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 482 946 3.0E-29
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 536 914 2.0E-25
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 523 857 1.0E-24
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 531 861 1.0E-24
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 536 915 6.0E-24
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 534 1028 7.0E-24
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 533 953 3.0E-22
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 504 899 6.0E-22
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 518 943 1.0E-21
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 518 943 1.0E-21
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 1384 1832 1.0E-20
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 519 913 3.0E-20
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 502 916 4.0E-20
sp|Q9XIF2|MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1 518 914 5.0E-20
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 530 961 5.0E-20
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 1374 1712 3.0E-18
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 530 914 3.0E-18
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 1374 1694 1.0E-17
sp|P95949|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1 507 898 1.0E-17
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 1366 1748 3.0E-17
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 1345 1771 4.0E-17
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 530 1015 4.0E-17
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 530 914 4.0E-17
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 1374 1712 5.0E-17
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 1345 1771 6.0E-17
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 1366 1771 1.0E-16
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 1388 1771 1.0E-16
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 1366 1771 1.0E-16
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 506 911 1.0E-16
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 505 911 8.0E-16
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 1365 1771 9.0E-16
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 1382 1747 1.0E-15
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 529 911 1.0E-15
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 1387 1804 2.0E-15
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 1387 1771 6.0E-15
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 1387 1771 6.0E-15
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 529 934 2.0E-14
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 1387 1706 7.0E-14
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 1387 1713 1.0E-13
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 1374 1740 2.0E-12
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 1387 1793 2.0E-12
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 1381 1694 2.0E-12
sp|O27830|HELX_METTH Uncharacterized ATP-dependent helicase MTH_1802 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1802 PE=3 SV=1 536 898 1.0E-11
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 1369 1706 2.0E-11
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 762 917 2.0E-11
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 815 912 2.0E-11
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 1386 1848 3.0E-11
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 806 912 4.0E-11
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 1387 1766 5.0E-11
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 815 912 5.0E-11
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 1387 1713 7.0E-11
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 1387 1712 3.0E-10
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 734 907 4.0E-10
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 1387 1828 6.0E-10
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 1366 1740 6.0E-10
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 1387 1712 6.0E-10
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 1387 1717 1.0E-09
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 809 906 4.0E-09
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 1386 1572 5.0E-09
sp|Q9UGP8|SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens GN=SEC63 PE=1 SV=2 1886 2029 6.0E-08
sp|Q8VHE0|SEC63_MOUSE Translocation protein SEC63 homolog OS=Mus musculus GN=Sec63 PE=1 SV=4 1886 2029 6.0E-08
sp|Q5R660|SEC63_PONAB Translocation protein SEC63 homolog OS=Pongo abelii GN=SEC63 PE=2 SV=1 1886 2029 6.0E-08
sp|Q58969|Y1574_METJA Uncharacterized ATP-dependent helicase MJ1574 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1574 PE=3 SV=1 536 920 7.0E-08
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 1357 1690 1.0E-07
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 734 906 1.0E-07
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 1386 1570 3.0E-07
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 1387 1570 4.0E-07
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 1387 1570 4.0E-07
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 532 736 2.0E-06
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 522 770 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup192
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4223
Ophiocordyceps australis 1348a (Ghana) OphauG2|5437
Ophiocordyceps australis map64 (Brazil) OphauB2|1852 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3897
Ophiocordyceps camponoti-floridani Ophcf2|04109
Ophiocordyceps camponoti-floridani Ophcf2|04554
Ophiocordyceps camponoti-rufipedis Ophun1|4478
Ophiocordyceps camponoti-rufipedis Ophun1|5490
Ophiocordyceps kimflemingae Ophio5|8406
Ophiocordyceps kimflemingae Ophio5|858
Ophiocordyceps subramaniannii Hirsu2|6747
Ophiocordyceps subramaniannii Hirsu2|7043

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1852
MSDPHRDVSQYKYSAMSNLVLQADRRFVTRRNDEATGDPESLAGRLSIRDMGGRIARDSAPKPKKPSGLAGIERG
ALGEGQDVLLREQRKRNAEAAKSTGVLGANDALIEGITYRPRTAATRATFDLILTSIASYIGDVPHEVVRSAADA
VLEYLKDDDMKDIDKKKEIDDIIGSTLGLKEYNELVNLGKKITDYNAQDDDEADAGGDSGKAEIDERQGVAVTFD
DEENDDDMVQEVHEASSEDEVDEDHYEGQDTDAPETREVVSDDEDMDHGSKTGHASKSGHGVPEIAARDIDAFWL
QRQIGMLYPDAHEQADKTKAALHILSAEPDEAGDEEKSLREVENELMELFDFEHHELVQRLVENRERVYWLTKLA
RAETAEQRAQVEREIASEGLQRLLTELRGGDVDKAKMEIKMDIDVPASLVAEKGVDEKAEGYLVGGLQPKKLINL
ENLVFDQGNHLMTNQKVRLPEGSTKRTFKGYEEIHVPPPRKRNDAEDALIPISDLPEWCRGPFSTTRSLNKIQSK
CYPSAFEGDGNMLVCAPTGSGKTNVSMLAILREIGKNRDAETGDIDLDAFKIVYIAPLKALVQEQVGNFGKRLEP
YGIRVSELTGDRQLTKQQIAETQIIVTTPEKWDVVTRKANDLTYTNLVRLIIIDEIHLLHDERGPVLESIVSRTI
RKTEQTGEAVRLVGLSATLPNYRDVASFLRVDMEKDLFHFDGSYRPCPLKQEFIGVTDRKAIKQVKTMNEVTYQK
VLEHVGSNRNQMLIFVHSRKDTAKTAKYIRDKAVDMETINKILRHDAGSREVLNEAASQATDQDLKDLLPHGFGI
HHAGMNRVDRSDVEDLFARGAIQVLVCTATLAWGVNLPAHTVIIKGTQVYSPEKGSWVELSPQDVLQMLGRAGRP
QYDTYGEGIIITTQSEMQYYLSLLNQQLPIESQFASKLVDNLNAEIVLGNVRTRDEGVEWLGYTYLFVRMLRSPG
LYQVGAEYEEDEGLEQKRVDLIHSAAVVLGQSSLIKYDEKSGRIASTELGRIASHYYITHGSMNTYNMHMQASTN
AIDLLRVFALSSEFKYMPVRQDEKVEVAKLLTQVPIPVKESVEEAQAKINVLLQAFISRLRLSGLALMADMVYVT
QSAGRILRAMFEIALKKGWAGVAKTALELCKMAEKRMWPTMSPLRQFGGCPSEVISKAERISVPWSSYFDLDAPR
MGELLGLPKQGRSVCAMVGKFPRVEVQAQVQPLTRWMLRVELSITGKFEWDDELHGAAESFWIIVEDCDGDEIVY
HDSFVLRKESVVGEAKEQVVEFSVAIGEPMAPNYFVSVISDRWMLAQTKLALPFERLTLPAKAGAHTELLELQPL
RVEALKEASHAALYDGWGQFNRIQTQVFNSLYKSDDNVFIGAPTGSGKTVCAEFALLRHWRAAGTGRAVYLAPFQ
EAVDARLDDWQKRLGHLDGGRAIVKLTGDTATDLGLLERADLVLATPGQWEVLSRQWKRRKNVQRVRLVVADDVH
LVDGAQGYVYEVVVSRMHYMATQTQQPVRMVALSVPVASARDLGEWVDARGHCIYNFSPQVRPVPLELHIQAFSS
APVPSLMLAMAKPAYLAIAHLSPAQPAMVFVSSRKQTRSTARDLLAACLADDAPDRFLHADVRQMGPLLQRVAEE
ALAEALSHGIAYYHEALSLADRRIVKHLFDLGAVQVLVASRDVCWELTSLAHLVIVMGTQLYDGREHRYLDYALS
DVLHMFGKSLLPGPDGRSRGLLMVPQPKRHYYRTFLHDALPVESHLHHYLHDAFVTEISTAMIESGDDAINWTTF
TYFYRRLLANPSYYGLTTTTHHALSNYMSNLVETTLRDLAESNIIDFDEHHGSVAPQNPAMIAAYYNISYITMQT
FLLSLGPRTKLKGILEIVTSATEFDSIHVRRHEGRLLRRIYHRLPVSMSDPVYDSPHFKAFVLLQAHFSRMQLPI
DLVKDQEVLLSRVLSLLSAMVDILASDGRLNAINAMEMSQMVVQAMWDRDSPLKQIPHFTPQLVHVANEFGIKDI
YDFMEAMNPQENADYPKLVKRLGLSQKQLAQAADFTNNKYPDLELELDVLDAHDIKAGEAAYLGIKITRNLQDDD
TADHDSTVHAPFYPPKKIENWWLVVGDDKAGNLLAIKRVTIGRHLSVRLEYTVPSAGEHRVKLMLMSDSYIGVDQ
EREFVVRAAEGMDLDSDQDDDE*
Coding >OphauB2|1852
ATGTCAGATCCTCATCGCGATGTCTCCCAGTACAAGTACTCGGCCATGTCCAACCTGGTTCTCCAGGCGGACCGT
CGTTTTGTTACGAGACGAAATGACGAGGCCACGGGGGACCCAGAGTCGCTTGCCGGGCGACTCAGCATTAGAGAC
ATGGGCGGTCGCATTGCCAGAGACTCAGCACCTAAGCCTAAGAAACCGTCGGGCCTGGCTGGCATTGAGCGAGGG
GCTTTGGGAGAGGGCCAAGATGTGTTGCTGAGGGAGCAACGCAAGCGAAATGCAGAAGCCGCCAAGAGCACTGGA
GTGCTTGGCGCCAATGACGCTTTGATTGAGGGCATCACCTATCGTCCTCGGACAGCAGCGACACGGGCGACGTTT
GATCTCATTCTCACCTCCATCGCAAGCTATATTGGCGACGTGCCTCACGAGGTTGTTCGCAGCGCCGCCGACGCC
GTTCTCGAGTATCTCAAGGATGATGACATGAAGGATATTGACAAGAAGAAGGAGATTGACGACATTATAGGCTCC
ACACTGGGCCTCAAGGAATACAACGAGCTCGTAAATCTGGGCAAGAAAATTACAGACTATAATGCACAAGACGAC
GACGAAGCCGATGCAGGCGGTGACAGCGGCAAGGCTGAAATTGACGAACGCCAGGGTGTTGCTGTCACCTTTGAC
GATGAAGAAAATGACGACGACATGGTGCAAGAGGTGCACGAGGCGTCGTCAGAGGACGAGGTTGATGAAGACCAT
TATGAAGGGCAAGACACTGACGCGCCCGAGACTCGCGAGGTGGTTAGCGATGACGAAGACATGGACCACGGGTCC
AAGACTGGGCACGCCAGCAAGAGTGGCCATGGCGTGCCTGAGATAGCAGCCCGAGATATTGATGCATTCTGGCTA
CAGCGACAAATCGGCATGCTTTACCCTGATGCGCATGAGCAGGCTGACAAAACTAAAGCTGCCCTTCACATCTTG
TCCGCAGAGCCTGACGAGGCTGGCGACGAGGAAAAGTCTCTTCGTGAGGTCGAAAATGAGCTCATGGAGCTCTTC
GACTTTGAGCACCACGAGCTCGTTCAGCGTCTTGTGGAAAACAGGGAAAGGGTGTACTGGCTGACAAAGCTGGCA
AGGGCTGAGACTGCTGAACAACGCGCCCAGGTTGAAAGAGAGATTGCGTCTGAAGGCTTGCAGAGGCTATTGACG
GAGCTCAGAGGTGGCGACGTGGACAAGGCCAAGATGGAAATCAAGATGGACATTGATGTGCCCGCGTCTCTTGTC
GCGGAAAAGGGAGTCGATGAAAAGGCCGAGGGTTATTTGGTGGGGGGCCTGCAGCCAAAGAAGCTCATCAATCTT
GAGAACCTGGTTTTTGACCAAGGCAACCACTTGATGACGAACCAAAAAGTCAGACTGCCCGAGGGCTCGACGAAG
CGCACCTTCAAGGGCTACGAGGAGATTCACGTTCCTCCGCCAAGAAAACGCAACGATGCGGAAGACGCTTTGATA
CCCATTAGCGACCTGCCAGAGTGGTGTCGAGGCCCCTTTAGCACGACGAGGTCGCTCAACAAGATTCAGTCCAAG
TGCTATCCCTCGGCCTTTGAAGGCGATGGCAACATGCTCGTTTGTGCGCCTACGGGCAGTGGCAAGACAAACGTT
TCCATGTTGGCAATTCTGAGAGAGATTGGCAAGAACCGGGATGCAGAGACGGGCGATATTGATCTTGACGCTTTC
AAGATTGTCTATATTGCTCCACTCAAGGCCCTGGTGCAGGAGCAGGTGGGCAATTTCGGCAAACGACTGGAGCCA
TATGGCATCCGCGTGTCCGAGTTGACGGGTGATCGGCAGCTCACCAAGCAGCAAATAGCCGAGACTCAAATCATT
GTGACGACGCCCGAGAAGTGGGACGTAGTGACGAGAAAGGCCAACGACCTGACATACACCAACCTTGTGCGTCTC
ATCATTATCGATGAAATCCATTTGCTGCACGATGAGCGCGGCCCTGTGCTGGAGAGCATAGTAAGCAGGACGATT
CGCAAGACGGAGCAGACTGGCGAAGCGGTGCGGCTTGTGGGCTTGTCTGCCACGCTTCCCAACTATCGAGACGTG
GCAAGCTTTTTGCGAGTGGACATGGAAAAGGACCTCTTTCACTTTGACGGGTCCTACAGGCCATGTCCTCTAAAG
CAGGAGTTTATCGGCGTGACGGATCGCAAGGCCATCAAGCAAGTCAAGACGATGAATGAGGTGACGTACCAAAAG
GTGCTGGAGCACGTTGGCAGCAACCGGAACCAGATGCTCATTTTTGTGCACTCGCGCAAAGACACGGCCAAGACG
GCCAAGTATATACGGGACAAGGCGGTGGACATGGAGACAATCAACAAAATCTTGCGGCATGATGCAGGAAGCCGA
GAAGTGCTCAACGAGGCAGCCAGCCAGGCGACGGACCAGGACCTCAAGGACCTGCTGCCGCACGGGTTCGGCATC
CATCACGCAGGCATGAACCGGGTGGACAGGAGTGACGTGGAAGACTTGTTTGCCAGGGGGGCGATTCAGGTGCTG
GTGTGCACGGCAACGCTGGCGTGGGGAGTCAACCTACCAGCACACACAGTCATCATCAAGGGCACACAGGTCTAC
TCTCCGGAAAAGGGCAGCTGGGTGGAGCTTAGTCCGCAAGACGTGCTCCAGATGCTTGGGCGGGCTGGGCGGCCG
CAGTACGACACGTATGGAGAAGGCATCATTATAACGACGCAGAGCGAGATGCAGTACTACCTATCACTGCTCAAC
CAGCAGCTCCCGATTGAGAGCCAGTTTGCCAGCAAGCTTGTGGACAATCTCAATGCGGAGATTGTGCTGGGCAAT
GTGAGGACGCGGGACGAGGGGGTGGAGTGGCTGGGCTACACGTATCTGTTTGTGCGGATGCTTCGGTCTCCAGGG
CTGTACCAGGTTGGGGCCGAGTATGAGGAGGACGAAGGACTGGAGCAGAAACGCGTGGACCTGATTCACTCGGCA
GCGGTGGTGCTCGGGCAGTCGAGCCTCATCAAGTACGATGAAAAGTCGGGGCGGATTGCGTCGACGGAGCTGGGG
CGGATTGCGTCGCACTACTACATTACGCATGGATCGATGAACACGTACAATATGCACATGCAGGCGTCGACGAAT
GCGATTGACCTGTTGCGCGTGTTTGCTCTCAGCTCCGAGTTCAAGTACATGCCGGTGCGGCAGGACGAAAAGGTG
GAAGTGGCCAAGCTGCTGACGCAGGTGCCGATTCCGGTCAAGGAGAGCGTGGAGGAGGCGCAGGCCAAGATTAAC
GTGCTGCTGCAGGCCTTTATCTCGCGGCTGCGGCTGTCGGGGCTGGCGCTCATGGCGGACATGGTGTATGTGACG
CAGAGCGCCGGGAGGATCCTGAGGGCCATGTTTGAGATTGCGCTCAAGAAGGGATGGGCGGGGGTGGCCAAGACG
GCGCTGGAGCTGTGCAAGATGGCGGAGAAGCGCATGTGGCCGACCATGTCGCCGCTGCGGCAGTTTGGCGGCTGC
CCGAGCGAGGTGATTAGCAAGGCGGAGCGCATCAGCGTGCCGTGGAGCAGCTACTTTGACCTGGATGCGCCGCGG
ATGGGGGAGCTGCTGGGGCTGCCCAAGCAGGGGCGCAGCGTGTGCGCCATGGTGGGCAAGTTTCCACGGGTCGAG
GTGCAAGCGCAGGTACAGCCGCTGACGCGGTGGATGCTGCGGGTGGAGCTGAGCATCACGGGCAAGTTTGAGTGG
GACGATGAGCTGCACGGGGCGGCGGAGAGCTTCTGGATTATTGTGGAGGACTGCGACGGCGACGAGATTGTCTAC
CACGACAGCTTTGTGCTGCGCAAGGAGAGTGTGGTGGGCGAGGCCAAGGAGCAGGTGGTGGAGTTTAGCGTGGCG
ATTGGCGAGCCCATGGCGCCCAACTACTTTGTGTCGGTGATATCGGACCGGTGGATGCTGGCGCAGACCAAGCTG
GCGCTGCCGTTTGAGCGGCTGACGCTGCCGGCCAAGGCTGGGGCGCACACGGAGCTGCTGGAACTGCAGCCGCTG
CGGGTAGAGGCGCTCAAGGAGGCGAGCCATGCGGCGCTGTATGACGGGTGGGGGCAGTTCAACCGGATACAGACG
CAGGTGTTCAACTCGCTGTACAAGAGCGACGACAATGTGTTTATCGGGGCGCCGACAGGCAGCGGCAAGACGGTG
TGTGCCGAGTTTGCGCTGCTGCGGCACTGGAGGGCGGCGGGGACGGGGCGGGCCGTCTATCTGGCGCCCTTTCAG
GAGGCGGTGGACGCGCGGCTGGACGACTGGCAGAAGCGGCTGGGGCACCTGGACGGCGGGCGGGCCATTGTCAAG
CTGACGGGCGACACGGCGACGGACCTGGGGCTGCTGGAGCGGGCGGACCTGGTGCTGGCGACGCCGGGGCAATGG
GAGGTGCTGTCGCGGCAGTGGAAGCGGCGCAAGAACGTGCAGCGGGTGCGGCTGGTGGTGGCGGACGACGTGCAC
CTGGTGGACGGGGCGCAGGGCTATGTGTACGAGGTGGTGGTGTCGCGCATGCACTACATGGCGACGCAGACGCAG
CAGCCGGTGCGCATGGTGGCGCTGAGCGTGCCCGTGGCCAGCGCGCGCGACCTGGGCGAGTGGGTGGACGCGCGC
GGCCACTGCATCTACAACTTTAGCCCCCAGGTGCGCCCCGTGCCGCTGGAGCTGCATATCCAGGCCTTTAGCAGC
GCGCCCGTGCCCTCGCTCATGCTGGCCATGGCCAAGCCGGCCTATCTGGCCATTGCGCACCTGTCGCCCGCCCAG
CCCGCCATGGTGTTTGTCTCGAGCCGCAAGCAGACGCGGAGCACGGCCCGCGACCTGCTGGCTGCCTGTCTGGCC
GACGACGCCCCCGACCGCTTTTTGCACGCCGACGTGCGCCAGATGGGTCCGCTGCTGCAGCGCGTGGCCGAGGAG
GCGCTGGCCGAGGCGCTCTCCCACGGCATTGCCTACTACCACGAGGCGCTGAGCCTGGCCGACCGCCGCATCGTC
AAGCATCTCTTTGACCTGGGCGCCGTCCAGGTGCTCGTGGCCTCGCGCGACGTGTGCTGGGAGCTGACGAGCCTC
GCCCACCTCGTCATTGTCATGGGCACCCAGCTCTACGACGGCCGCGAGCACCGCTATCTCGACTATGCCCTCAGC
GACGTGCTGCACATGTTTGGCAAGTCGCTGCTGCCCGGCCCCGATGGCCGTTCGCGCGGCCTCCTCATGGTGCCC
CAGCCCAAGCGCCACTACTACCGCACCTTTCTCCACGACGCCCTGCCCGTCGAGTCGCATCTGCACCACTACCTG
CACGATGCCTTTGTCACTGAAATCAGCACCGCCATGATTGAGTCGGGCGACGACGCCATCAACTGGACCACCTTT
ACCTACTTTTACCGCCGCCTGCTCGCCAACCCCAGCTACTACGGCCTGACCACCACCACGCACCACGCCCTCAGC
AACTACATGTCCAACCTGGTGGAGACGACGCTGCGCGACCTGGCCGAGTCCAACATTATCGACTTTGACGAGCAC
CACGGCTCCGTCGCCCCCCAGAACCCCGCCATGATTGCCGCCTACTACAACATCTCGTACATCACCATGCAGACC
TTTCTCCTCTCCCTCGGCCCCCGCACCAAGCTCAAGGGCATCTTGGAAATCGTCACCTCGGCCACCGAGTTTGAC
TCCATCCACGTCCGCCGCCACGAGGGCCGCCTGCTGCGCCGCATCTACCACCGCCTGCCCGTCTCCATGTCGGAC
CCCGTCTACGACTCGCCTCACTTCAAGGCCTTTGTCTTGCTCCAGGCTCACTTTTCCCGCATGCAGCTGCCCATT
GACCTTGTCAAGGACCAGGAGGTCTTGCTGTCCAGGGTCCTGAGCCTCCTGAGCGCCATGGTGGACATTCTCGCC
TCTGACGGCCGCCTCAACGCAATCAACGCCATGGAAATGTCGCAAATGGTGGTGCAGGCCATGTGGGACCGTGAT
AGCCCCTTGAAGCAAATTCCTCACTTTACACCCCAGCTTGTCCATGTTGCCAATGAATTTGGAATCAAGGACATT
TACGACTTCATGGAGGCCATGAACCCCCAAGAAAACGCCGACTACCCCAAGCTGGTCAAGCGTCTAGGTCTTTCA
CAGAAGCAGCTGGCTCAAGCGGCCGACTTTACCAACAACAAGTATCCCGATCTCGAGCTCGAGCTCGACGTGCTC
GATGCCCACGACATCAAGGCCGGCGAGGCCGCCTACCTGGGCATCAAGATTACGCGCAACCTCCAAGACGACGAC
ACGGCCGACCATGACTCTACCGTCCACGCCCCCTTTTATCCGCCCAAGAAGATTGAGAATTGGTGGCTGGTGGTG
GGTGACGACAAGGCTGGCAACCTGCTGGCCATCAAGAGAGTGACCATTGGCCGCCACTTGTCGGTGCGGCTCGAG
TACACGGTGCCGTCGGCGGGCGAGCATCGTGTCAAGTTGATGCTCATGAGCGACAGCTACATTGGCGTGGACCAA
GAACGCGAGTTTGTCGTCAGGGCGGCTGAGGGAATGGACCTTGACTCAGACCAAGATGACGACGAATAG
Transcript >OphauB2|1852
ATGTCAGATCCTCATCGCGATGTCTCCCAGTACAAGTACTCGGCCATGTCCAACCTGGTTCTCCAGGCGGACCGT
CGTTTTGTTACGAGACGAAATGACGAGGCCACGGGGGACCCAGAGTCGCTTGCCGGGCGACTCAGCATTAGAGAC
ATGGGCGGTCGCATTGCCAGAGACTCAGCACCTAAGCCTAAGAAACCGTCGGGCCTGGCTGGCATTGAGCGAGGG
GCTTTGGGAGAGGGCCAAGATGTGTTGCTGAGGGAGCAACGCAAGCGAAATGCAGAAGCCGCCAAGAGCACTGGA
GTGCTTGGCGCCAATGACGCTTTGATTGAGGGCATCACCTATCGTCCTCGGACAGCAGCGACACGGGCGACGTTT
GATCTCATTCTCACCTCCATCGCAAGCTATATTGGCGACGTGCCTCACGAGGTTGTTCGCAGCGCCGCCGACGCC
GTTCTCGAGTATCTCAAGGATGATGACATGAAGGATATTGACAAGAAGAAGGAGATTGACGACATTATAGGCTCC
ACACTGGGCCTCAAGGAATACAACGAGCTCGTAAATCTGGGCAAGAAAATTACAGACTATAATGCACAAGACGAC
GACGAAGCCGATGCAGGCGGTGACAGCGGCAAGGCTGAAATTGACGAACGCCAGGGTGTTGCTGTCACCTTTGAC
GATGAAGAAAATGACGACGACATGGTGCAAGAGGTGCACGAGGCGTCGTCAGAGGACGAGGTTGATGAAGACCAT
TATGAAGGGCAAGACACTGACGCGCCCGAGACTCGCGAGGTGGTTAGCGATGACGAAGACATGGACCACGGGTCC
AAGACTGGGCACGCCAGCAAGAGTGGCCATGGCGTGCCTGAGATAGCAGCCCGAGATATTGATGCATTCTGGCTA
CAGCGACAAATCGGCATGCTTTACCCTGATGCGCATGAGCAGGCTGACAAAACTAAAGCTGCCCTTCACATCTTG
TCCGCAGAGCCTGACGAGGCTGGCGACGAGGAAAAGTCTCTTCGTGAGGTCGAAAATGAGCTCATGGAGCTCTTC
GACTTTGAGCACCACGAGCTCGTTCAGCGTCTTGTGGAAAACAGGGAAAGGGTGTACTGGCTGACAAAGCTGGCA
AGGGCTGAGACTGCTGAACAACGCGCCCAGGTTGAAAGAGAGATTGCGTCTGAAGGCTTGCAGAGGCTATTGACG
GAGCTCAGAGGTGGCGACGTGGACAAGGCCAAGATGGAAATCAAGATGGACATTGATGTGCCCGCGTCTCTTGTC
GCGGAAAAGGGAGTCGATGAAAAGGCCGAGGGTTATTTGGTGGGGGGCCTGCAGCCAAAGAAGCTCATCAATCTT
GAGAACCTGGTTTTTGACCAAGGCAACCACTTGATGACGAACCAAAAAGTCAGACTGCCCGAGGGCTCGACGAAG
CGCACCTTCAAGGGCTACGAGGAGATTCACGTTCCTCCGCCAAGAAAACGCAACGATGCGGAAGACGCTTTGATA
CCCATTAGCGACCTGCCAGAGTGGTGTCGAGGCCCCTTTAGCACGACGAGGTCGCTCAACAAGATTCAGTCCAAG
TGCTATCCCTCGGCCTTTGAAGGCGATGGCAACATGCTCGTTTGTGCGCCTACGGGCAGTGGCAAGACAAACGTT
TCCATGTTGGCAATTCTGAGAGAGATTGGCAAGAACCGGGATGCAGAGACGGGCGATATTGATCTTGACGCTTTC
AAGATTGTCTATATTGCTCCACTCAAGGCCCTGGTGCAGGAGCAGGTGGGCAATTTCGGCAAACGACTGGAGCCA
TATGGCATCCGCGTGTCCGAGTTGACGGGTGATCGGCAGCTCACCAAGCAGCAAATAGCCGAGACTCAAATCATT
GTGACGACGCCCGAGAAGTGGGACGTAGTGACGAGAAAGGCCAACGACCTGACATACACCAACCTTGTGCGTCTC
ATCATTATCGATGAAATCCATTTGCTGCACGATGAGCGCGGCCCTGTGCTGGAGAGCATAGTAAGCAGGACGATT
CGCAAGACGGAGCAGACTGGCGAAGCGGTGCGGCTTGTGGGCTTGTCTGCCACGCTTCCCAACTATCGAGACGTG
GCAAGCTTTTTGCGAGTGGACATGGAAAAGGACCTCTTTCACTTTGACGGGTCCTACAGGCCATGTCCTCTAAAG
CAGGAGTTTATCGGCGTGACGGATCGCAAGGCCATCAAGCAAGTCAAGACGATGAATGAGGTGACGTACCAAAAG
GTGCTGGAGCACGTTGGCAGCAACCGGAACCAGATGCTCATTTTTGTGCACTCGCGCAAAGACACGGCCAAGACG
GCCAAGTATATACGGGACAAGGCGGTGGACATGGAGACAATCAACAAAATCTTGCGGCATGATGCAGGAAGCCGA
GAAGTGCTCAACGAGGCAGCCAGCCAGGCGACGGACCAGGACCTCAAGGACCTGCTGCCGCACGGGTTCGGCATC
CATCACGCAGGCATGAACCGGGTGGACAGGAGTGACGTGGAAGACTTGTTTGCCAGGGGGGCGATTCAGGTGCTG
GTGTGCACGGCAACGCTGGCGTGGGGAGTCAACCTACCAGCACACACAGTCATCATCAAGGGCACACAGGTCTAC
TCTCCGGAAAAGGGCAGCTGGGTGGAGCTTAGTCCGCAAGACGTGCTCCAGATGCTTGGGCGGGCTGGGCGGCCG
CAGTACGACACGTATGGAGAAGGCATCATTATAACGACGCAGAGCGAGATGCAGTACTACCTATCACTGCTCAAC
CAGCAGCTCCCGATTGAGAGCCAGTTTGCCAGCAAGCTTGTGGACAATCTCAATGCGGAGATTGTGCTGGGCAAT
GTGAGGACGCGGGACGAGGGGGTGGAGTGGCTGGGCTACACGTATCTGTTTGTGCGGATGCTTCGGTCTCCAGGG
CTGTACCAGGTTGGGGCCGAGTATGAGGAGGACGAAGGACTGGAGCAGAAACGCGTGGACCTGATTCACTCGGCA
GCGGTGGTGCTCGGGCAGTCGAGCCTCATCAAGTACGATGAAAAGTCGGGGCGGATTGCGTCGACGGAGCTGGGG
CGGATTGCGTCGCACTACTACATTACGCATGGATCGATGAACACGTACAATATGCACATGCAGGCGTCGACGAAT
GCGATTGACCTGTTGCGCGTGTTTGCTCTCAGCTCCGAGTTCAAGTACATGCCGGTGCGGCAGGACGAAAAGGTG
GAAGTGGCCAAGCTGCTGACGCAGGTGCCGATTCCGGTCAAGGAGAGCGTGGAGGAGGCGCAGGCCAAGATTAAC
GTGCTGCTGCAGGCCTTTATCTCGCGGCTGCGGCTGTCGGGGCTGGCGCTCATGGCGGACATGGTGTATGTGACG
CAGAGCGCCGGGAGGATCCTGAGGGCCATGTTTGAGATTGCGCTCAAGAAGGGATGGGCGGGGGTGGCCAAGACG
GCGCTGGAGCTGTGCAAGATGGCGGAGAAGCGCATGTGGCCGACCATGTCGCCGCTGCGGCAGTTTGGCGGCTGC
CCGAGCGAGGTGATTAGCAAGGCGGAGCGCATCAGCGTGCCGTGGAGCAGCTACTTTGACCTGGATGCGCCGCGG
ATGGGGGAGCTGCTGGGGCTGCCCAAGCAGGGGCGCAGCGTGTGCGCCATGGTGGGCAAGTTTCCACGGGTCGAG
GTGCAAGCGCAGGTACAGCCGCTGACGCGGTGGATGCTGCGGGTGGAGCTGAGCATCACGGGCAAGTTTGAGTGG
GACGATGAGCTGCACGGGGCGGCGGAGAGCTTCTGGATTATTGTGGAGGACTGCGACGGCGACGAGATTGTCTAC
CACGACAGCTTTGTGCTGCGCAAGGAGAGTGTGGTGGGCGAGGCCAAGGAGCAGGTGGTGGAGTTTAGCGTGGCG
ATTGGCGAGCCCATGGCGCCCAACTACTTTGTGTCGGTGATATCGGACCGGTGGATGCTGGCGCAGACCAAGCTG
GCGCTGCCGTTTGAGCGGCTGACGCTGCCGGCCAAGGCTGGGGCGCACACGGAGCTGCTGGAACTGCAGCCGCTG
CGGGTAGAGGCGCTCAAGGAGGCGAGCCATGCGGCGCTGTATGACGGGTGGGGGCAGTTCAACCGGATACAGACG
CAGGTGTTCAACTCGCTGTACAAGAGCGACGACAATGTGTTTATCGGGGCGCCGACAGGCAGCGGCAAGACGGTG
TGTGCCGAGTTTGCGCTGCTGCGGCACTGGAGGGCGGCGGGGACGGGGCGGGCCGTCTATCTGGCGCCCTTTCAG
GAGGCGGTGGACGCGCGGCTGGACGACTGGCAGAAGCGGCTGGGGCACCTGGACGGCGGGCGGGCCATTGTCAAG
CTGACGGGCGACACGGCGACGGACCTGGGGCTGCTGGAGCGGGCGGACCTGGTGCTGGCGACGCCGGGGCAATGG
GAGGTGCTGTCGCGGCAGTGGAAGCGGCGCAAGAACGTGCAGCGGGTGCGGCTGGTGGTGGCGGACGACGTGCAC
CTGGTGGACGGGGCGCAGGGCTATGTGTACGAGGTGGTGGTGTCGCGCATGCACTACATGGCGACGCAGACGCAG
CAGCCGGTGCGCATGGTGGCGCTGAGCGTGCCCGTGGCCAGCGCGCGCGACCTGGGCGAGTGGGTGGACGCGCGC
GGCCACTGCATCTACAACTTTAGCCCCCAGGTGCGCCCCGTGCCGCTGGAGCTGCATATCCAGGCCTTTAGCAGC
GCGCCCGTGCCCTCGCTCATGCTGGCCATGGCCAAGCCGGCCTATCTGGCCATTGCGCACCTGTCGCCCGCCCAG
CCCGCCATGGTGTTTGTCTCGAGCCGCAAGCAGACGCGGAGCACGGCCCGCGACCTGCTGGCTGCCTGTCTGGCC
GACGACGCCCCCGACCGCTTTTTGCACGCCGACGTGCGCCAGATGGGTCCGCTGCTGCAGCGCGTGGCCGAGGAG
GCGCTGGCCGAGGCGCTCTCCCACGGCATTGCCTACTACCACGAGGCGCTGAGCCTGGCCGACCGCCGCATCGTC
AAGCATCTCTTTGACCTGGGCGCCGTCCAGGTGCTCGTGGCCTCGCGCGACGTGTGCTGGGAGCTGACGAGCCTC
GCCCACCTCGTCATTGTCATGGGCACCCAGCTCTACGACGGCCGCGAGCACCGCTATCTCGACTATGCCCTCAGC
GACGTGCTGCACATGTTTGGCAAGTCGCTGCTGCCCGGCCCCGATGGCCGTTCGCGCGGCCTCCTCATGGTGCCC
CAGCCCAAGCGCCACTACTACCGCACCTTTCTCCACGACGCCCTGCCCGTCGAGTCGCATCTGCACCACTACCTG
CACGATGCCTTTGTCACTGAAATCAGCACCGCCATGATTGAGTCGGGCGACGACGCCATCAACTGGACCACCTTT
ACCTACTTTTACCGCCGCCTGCTCGCCAACCCCAGCTACTACGGCCTGACCACCACCACGCACCACGCCCTCAGC
AACTACATGTCCAACCTGGTGGAGACGACGCTGCGCGACCTGGCCGAGTCCAACATTATCGACTTTGACGAGCAC
CACGGCTCCGTCGCCCCCCAGAACCCCGCCATGATTGCCGCCTACTACAACATCTCGTACATCACCATGCAGACC
TTTCTCCTCTCCCTCGGCCCCCGCACCAAGCTCAAGGGCATCTTGGAAATCGTCACCTCGGCCACCGAGTTTGAC
TCCATCCACGTCCGCCGCCACGAGGGCCGCCTGCTGCGCCGCATCTACCACCGCCTGCCCGTCTCCATGTCGGAC
CCCGTCTACGACTCGCCTCACTTCAAGGCCTTTGTCTTGCTCCAGGCTCACTTTTCCCGCATGCAGCTGCCCATT
GACCTTGTCAAGGACCAGGAGGTCTTGCTGTCCAGGGTCCTGAGCCTCCTGAGCGCCATGGTGGACATTCTCGCC
TCTGACGGCCGCCTCAACGCAATCAACGCCATGGAAATGTCGCAAATGGTGGTGCAGGCCATGTGGGACCGTGAT
AGCCCCTTGAAGCAAATTCCTCACTTTACACCCCAGCTTGTCCATGTTGCCAATGAATTTGGAATCAAGGACATT
TACGACTTCATGGAGGCCATGAACCCCCAAGAAAACGCCGACTACCCCAAGCTGGTCAAGCGTCTAGGTCTTTCA
CAGAAGCAGCTGGCTCAAGCGGCCGACTTTACCAACAACAAGTATCCCGATCTCGAGCTCGAGCTCGACGTGCTC
GATGCCCACGACATCAAGGCCGGCGAGGCCGCCTACCTGGGCATCAAGATTACGCGCAACCTCCAAGACGACGAC
ACGGCCGACCATGACTCTACCGTCCACGCCCCCTTTTATCCGCCCAAGAAGATTGAGAATTGGTGGCTGGTGGTG
GGTGACGACAAGGCTGGCAACCTGCTGGCCATCAAGAGAGTGACCATTGGCCGCCACTTGTCGGTGCGGCTCGAG
TACACGGTGCCGTCGGCGGGCGAGCATCGTGTCAAGTTGATGCTCATGAGCGACAGCTACATTGGCGTGGACCAA
GAACGCGAGTTTGTCGTCAGGGCGGCTGAGGGAATGGACCTTGACTCAGACCAAGATGACGACGAATAG
Gene >OphauB2|1852
ATGTCAGATCCTCATCGCGATGTCTCCCAGTACAAGTACTCGGCCATGTCCAACCTGGTTCTCCAGGCGGACCGT
CGTTTTGTTACGAGACGAAATGACGAGGCCACGGGGGACCCAGAGTCGCTTGCCGGGCGACTCAGCATTAGAGAC
ATGGGCGGTCGCATTGCCAGAGACTCAGCACCTAAGCCTAAGAAACCGTCGGGCCTGGCTGGCATTGAGCGAGGG
GCTTTGGGAGAGGGCCAAGATGTGTTGCTGAGGGAGCAACGCAAGCGAAATGCAGAAGCCGCCAAGAGCACTGGA
GTGCTTGGCGCCAATGACGCTTTGATTGAGGGCATCACCTATCGTCCTCGGACAGCAGCGACACGGGCGACGTTT
GATCTCATTCTCACCTCCATCGCAAGCTATATTGGCGACGTGCCTCACGAGGTTGTTCGCAGCGCCGCCGACGCC
GTTCTCGAGTATCTCAAGGATGATGACATGAAGGATATTGACAAGAAGAAGGAGATTGACGACATTATAGGCTCC
ACACTGGGCCTCAAGGAATACAACGAGCTCGTAAATCTGGGCAAGAAAATTACAGACTATAATGCACAAGACGAC
GACGAAGCCGATGCAGGCGGTGACAGCGGCAAGGCTGAAATTGACGAACGCCAGGGTGTTGCTGTCACCTTTGAC
GATGAAGAAAATGACGACGACATGGTGCAAGAGGTGCACGAGGCGTCGTCAGAGGACGAGGTTGATGAAGACCAT
TATGAAGGGCAAGACACTGACGCGCCCGAGACTCGCGAGGTGGTTAGCGATGACGAAGACATGGACCACGGGTCC
AAGACTGGGCACGCCAGCAAGAGTGGCCATGGCGTGCCTGAGATAGCAGCCCGAGATATTGATGCATTCTGGCTA
CAGCGACAAATCGGCATGCTTTACCCTGATGCGCATGAGCAGGCTGACAAAACTAAAGCTGCCCTTCACATCTTG
TCCGCAGAGCCTGACGAGGCTGGCGACGAGGAAAAGTCTCTTCGTGAGGTCGAAAATGAGCTCATGGAGCTCTTC
GACTTTGAGCACCACGAGCTCGTTCAGCGTCTTGTGGAAAACAGGGAAAGGGTGTACTGGCTGACAAAGCTGGCA
AGGGCTGAGACTGCTGAACAACGCGCCCAGGTTGAAAGAGAGATTGCGTCTGAAGGCTTGCAGAGGCTATTGACG
GAGCTCAGAGGTGGCGACGTGGACAAGGCCAAGATGGAAATCAAGATGGACATTGATGTGCCCGCGTCTCTTGTC
GCGGAAAAGGGAGTCGATGAAAAGGCCGAGGGTTATTTGGTGGGGGGCCTGCAGCCAAAGAAGCTCATCAATCTT
GAGAACCTGGTTTTTGACCAAGGCAACCACTTGATGACGAACCAAAAAGTCAGACTGCCCGAGGGCTCGACGAAG
CGCACCTTCAAGGGCTACGAGGAGATTCACGTTCCTCCGCCAAGAAAACGCAACGATGCGGAAGACGCTTTGATA
CCCATTAGCGACCTGCCAGAGTGGTGTCGAGGCCCCTTTAGCACGACGAGGTCGCTCAACAAGATTCAGTCCAAG
TGCTATCCCTCGGCCTTTGAAGGCGATGGCAACATGCTCGTTTGTGCGCCTACGGGCAGTGGCAAGACAAACGTT
TCCATGTTGGCAATTCTGAGAGAGATTGGCAAGAACCGGGATGCAGAGACGGGCGATATTGATCTTGACGCTTTC
AAGATTGTCTATATTGCTCCACTCAAGGCCCTGGTGCAGGAGCAGGTGGGCAATTTCGGCAAACGACTGGAGCCA
TATGGCATCCGCGTGTCCGAGTTGACGGGTGATCGGCAGCTCACCAAGCAGCAAATAGCCGAGACTCAAATCATT
GTGACGACGCCCGAGAAGTGGGACGTAGTGACGAGAAAGGCCAACGACCTGACATACACCAACCTTGTGCGTCTC
ATCATTATCGATGAAATCCATTTGCTGCACGATGAGCGCGGCCCTGTGCTGGAGAGCATAGTAAGCAGGACGATT
CGCAAGACGGAGCAGACTGGCGAAGCGGTGCGGCTTGTGGGCTTGTCTGCCACGCTTCCCAACTATCGAGACGTG
GCAAGCTTTTTGCGAGTGGACATGGAAAAGGACCTCTTTCACTTTGACGGGTCCTACAGGCCATGTCCTCTAAAG
CAGGAGTTTATCGGCGTGACGGATCGCAAGGCCATCAAGCAAGTCAAGACGATGAATGAGGTGACGTACCAAAAG
GTGCTGGAGCACGTTGGCAGCAACCGGAACCAGATGCTCATTTTTGTGCACTCGCGCAAAGACACGGCCAAGACG
GCCAAGTATATACGGGACAAGGCGGTGGACATGGAGACAATCAACAAAATCTTGCGGCATGATGCAGGAAGCCGA
GAAGTGCTCAACGAGGCAGCCAGCCAGGCGACGGACCAGGACCTCAAGGACCTGCTGCCGCACGGGTTCGGCATC
CATCACGCAGGCATGAACCGGGTGGACAGGAGTGACGTGGAAGACTTGTTTGCCAGGGGGGCGATTCAGGTGCTG
GTGTGCACGGCAACGCTGGCGTGGGGAGTCAACCTACCAGCACACACAGTCATCATCAAGGGCACACAGGTCTAC
TCTCCGGAAAAGGGCAGCTGGGTGGAGCTTAGTCCGCAAGACGTGCTCCAGATGCTTGGGCGGGCTGGGCGGCCG
CAGTACGACACGTATGGAGAAGGCATCATTATAACGACGCAGAGCGAGATGCAGTACTACCTATCACTGCTCAAC
CAGCAGCTCCCGATTGAGAGCCAGTTTGCCAGCAAGCTTGTGGACAATCTCAATGCGGAGATTGTGCTGGGCAAT
GTGAGGACGCGGGACGAGGGGGTGGAGTGGCTGGGCTACACGTATCTGTTTGTGCGGATGCTTCGGTCTCCAGGG
CTGTACCAGGTTGGGGCCGAGTATGAGGAGGACGAAGGACTGGAGCAGAAACGCGTGGACCTGATTCACTCGGCA
GCGGTGGTGCTCGGGCAGTCGAGCCTCATCAAGTACGATGAAAAGTCGGGGCGGATTGCGTCGACGGAGCTGGGG
CGGATTGCGTCGCACTACTACATTACGCATGGATCGATGAACACGTACAATATGCACATGCAGGCGTCGACGAAT
GCGATTGACCTGTTGCGCGTGTTTGCTCTCAGCTCCGAGTTCAAGTACATGCCGGTGCGGCAGGACGAAAAGGTG
GAAGTGGCCAAGCTGCTGACGCAGGTGCCGATTCCGGTCAAGGAGAGCGTGGAGGAGGCGCAGGCCAAGATTAAC
GTGCTGCTGCAGGCCTTTATCTCGCGGCTGCGGCTGTCGGGGCTGGCGCTCATGGCGGACATGGTGTATGTGACG
CAGAGCGCCGGGAGGATCCTGAGGGCCATGTTTGAGATTGCGCTCAAGAAGGGATGGGCGGGGGTGGCCAAGACG
GCGCTGGAGCTGTGCAAGATGGCGGAGAAGCGCATGTGGCCGACCATGTCGCCGCTGCGGCAGTTTGGCGGCTGC
CCGAGCGAGGTGATTAGCAAGGCGGAGCGCATCAGCGTGCCGTGGAGCAGCTACTTTGACCTGGATGCGCCGCGG
ATGGGGGAGCTGCTGGGGCTGCCCAAGCAGGGGCGCAGCGTGTGCGCCATGGTGGGCAAGTTTCCACGGGTCGAG
GTGCAAGCGCAGGTACAGCCGCTGACGCGGTGGATGCTGCGGGTGGAGCTGAGCATCACGGGCAAGTTTGAGTGG
GACGATGAGCTGCACGGGGCGGCGGAGAGCTTCTGGATTATTGTGGAGGACTGCGACGGCGACGAGATTGTCTAC
CACGACAGCTTTGTGCTGCGCAAGGAGAGTGTGGTGGGCGAGGCCAAGGAGCAGGTGGTGGAGTTTAGCGTGGCG
ATTGGCGAGCCCATGGCGCCCAACTACTTTGTGTCGGTGATATCGGACCGGTGGATGCTGGCGCAGACCAAGCTG
GCGCTGCCGTTTGAGCGGCTGACGCTGCCGGCCAAGGCTGGGGCGCACACGGAGCTGCTGGAACTGCAGCCGCTG
CGGGTAGAGGCGCTCAAGGAGGCGAGCCATGCGGCGCTGTATGACGGGTGGGGGCAGTTCAACCGGATACAGACG
CAGGTGTTCAACTCGCTGTACAAGAGCGACGACAATGTGTTTATCGGGGCGCCGACAGGCAGCGGCAAGACGGTG
TGTGCCGAGTTTGCGCTGCTGCGGCACTGGAGGGCGGCGGGGACGGGGCGGGCCGTCTATCTGGCGCCCTTTCAG
GAGGCGGTGGACGCGCGGCTGGACGACTGGCAGAAGCGGCTGGGGCACCTGGACGGCGGGCGGGCCATTGTCAAG
CTGACGGGCGACACGGCGACGGACCTGGGGCTGCTGGAGCGGGCGGACCTGGTGCTGGCGACGCCGGGGCAATGG
GAGGTGCTGTCGCGGCAGTGGAAGCGGCGCAAGAACGTGCAGCGGGTGCGGCTGGTGGTGGCGGACGACGTGCAC
CTGGTGGACGGGGCGCAGGGCTATGTGTACGAGGTGGTGGTGTCGCGCATGCACTACATGGCGACGCAGACGCAG
CAGCCGGTGCGCATGGTGGCGCTGAGCGTGCCCGTGGCCAGCGCGCGCGACCTGGGCGAGTGGGTGGACGCGCGC
GGCCACTGCATCTACAACTTTAGCCCCCAGGTGCGCCCCGTGCCGCTGGAGCTGCATATCCAGGCCTTTAGCAGC
GCGCCCGTGCCCTCGCTCATGCTGGCCATGGCCAAGCCGGCCTATCTGGCCATTGCGCACCTGTCGCCCGCCCAG
CCCGCCATGGTGTTTGTCTCGAGCCGCAAGCAGACGCGGAGCACGGCCCGCGACCTGCTGGCTGCCTGTCTGGCC
GACGACGCCCCCGACCGCTTTTTGCACGCCGACGTGCGCCAGATGGGTCCGCTGCTGCAGCGCGTGGCCGAGGAG
GCGCTGGCCGAGGCGCTCTCCCACGGCATTGCCTACTACCACGAGGCGCTGAGCCTGGCCGACCGCCGCATCGTC
AAGCATCTCTTTGACCTGGGCGCCGTCCAGGTGCTCGTGGCCTCGCGCGACGTGTGCTGGGAGCTGACGAGCCTC
GCCCACCTCGTCATTGTCATGGGCACCCAGCTCTACGACGGCCGCGAGCACCGCTATCTCGACTATGCCCTCAGC
GACGTGCTGCACATGTTTGGCAAGTCGCTGCTGCCCGGCCCCGATGGCCGTTCGCGCGGCCTCCTCATGGTGCCC
CAGCCCAAGCGCCACTACTACCGCACCTTTCTCCACGACGCCCTGCCCGTCGAGTCGCATCTGCACCACTACCTG
CACGATGCCTTTGTCACTGAAATCAGCACCGCCATGATTGAGTCGGGCGACGACGCCATCAACTGGACCACCTTT
ACCTACTTTTACCGCCGCCTGCTCGCCAACCCCAGCTACTACGGCCTGACCACCACCACGCACCACGCCCTCAGC
AACTACATGTCCAACCTGGTGGAGACGACGCTGCGCGACCTGGCCGAGTCCAACATTATCGACTTTGACGAGCAC
CACGGCTCCGTCGCCCCCCAGAACCCCGCCATGATTGCCGCCTACTACAACATCTCGTACATCACCATGCAGACC
TTTCTCCTCTCCCTCGGCCCCCGCACCAAGCTCAAGGGCATCTTGGAAATCGTCACCTCGGCCACCGAGTTTGAC
TCCATCCACGTCCGCCGCCACGAGGGCCGCCTGCTGCGCCGCATCTACCACCGCCTGCCCGTCTCCATGTCGGAC
CCCGTCTACGACTCGCCTCACTTCAAGGCCTTTGTCTTGCTCCAGGCTCACTTTTCCCGCATGCAGCTGCCCATT
GACCTTGTCAAGGACCAGGAGGTCTTGCTGTCCAGGGTCCTGAGCCTCCTGAGCGCCATGGTGGACATTCTCGCC
TCTGACGGCCGCCTCAACGCAATCAACGCCATGGAAATGTCGCAAATGGTGGTGCAGGCCATGTGGGACCGTGAT
AGCCCCTTGAAGCAAATTCCTCACTTTACACCCCAGCTTGTCCATGTTGCCAATGAATTTGGGTAAATTTTTTTT
TCTCTTTTCTTTTTTTTCCTCTCTCCCTCCTCCTCTCTGCCAACTCGGGCCTTCACTCTGCTAACCCCCAACCTT
GTCGTGACAGAATCAAGGACATTTACGACTTCATGGAGGCCATGAACCCCCAAGAAAACGCCGACTACCCCAAGC
TGGTCAAGCGTCTAGGTCTTTCACAGAAGCAGCTGGCTCAAGCGGCCGACTTTACCAACAACAAGTATCCCGATC
TCGAGCTCGAGCTCGACGTGCTCGATGCCCACGACATCAAGGCCGGCGAGGCCGCCTACCTGGGCATCAAGATTA
CGCGCAACCTCCAAGACGACGACACGGCCGACCATGACTCTACCGTCCACGCCCCCTTTTATCCGCCCAAGAAGA
TTGAGAATTGGTGGCTGGTGGTGGGTGACGACAAGGCTGGCAACCTGCTGGCCATCAAGAGAGTGACCATTGGCC
GCCACTTGTCGGTGCGGCTCGAGTACACGGTGCCGTCGGCGGGCGAGCATCGTGTCAAGTTGATGCTCATGAGCG
ACAGCTACATTGGCGTGGACCAAGAACGCGAGTTTGTCGTCAGGGCGGCTGAGGGAATGGACCTTGACTCAGACC
AAGATGACGACGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail