Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1845
Gene name
LocationContig_152:9762..13505
Strand-
Gene length (bp)3743
Transcript length (bp)3471
Coding sequence length (bp)3471
Protein length (aa) 1157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 3.5E-33 830 981
PF00412 LIM LIM domain 2.0E-08 102 160
PF00412 LIM LIM domain 2.9E-12 166 222
PF00412 LIM LIM domain 1.6E-05 475 530

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 100 1073 0.0E+00
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 102 1063 4.0E-154
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 101 255 1.0E-25
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 101 255 2.0E-25
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 101 255 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 100 1073 0.0E+00
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 102 1063 4.0E-154
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 101 255 1.0E-25
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 101 255 2.0E-25
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 101 255 2.0E-25
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 101 255 2.0E-25
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 101 255 3.0E-25
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 56 256 2.0E-20
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 52 256 4.0E-20
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 52 256 8.0E-20
sp|Q63744|RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus GN=Dlc1 PE=1 SV=3 762 1015 2.0E-19
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 46 256 4.0E-19
sp|A7E300|RHG07_BOVIN Rho GTPase-activating protein 7 OS=Bos taurus GN=DLC1 PE=2 SV=1 762 1015 5.0E-19
sp|B9VTT2|RHG07_CANLF Rho GTPase-activating protein 7 OS=Canis lupus familiaris GN=DLC1 PE=2 SV=1 762 1015 5.0E-19
sp|Q9R0Z9|RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus GN=Dlc1 PE=1 SV=2 762 1015 7.0E-19
sp|Q96QB1|RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens GN=DLC1 PE=1 SV=4 762 1015 8.0E-19
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 46 260 1.0E-18
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 102 257 5.0E-18
sp|Q8K0Q5|RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus GN=Arhgap18 PE=1 SV=1 770 978 7.0E-18
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 102 255 2.0E-17
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 102 255 2.0E-17
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 102 255 3.0E-17
sp|Q5TG30|RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens GN=ARHGAP40 PE=3 SV=3 802 987 3.0E-17
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 102 255 4.0E-17
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 102 255 5.0E-17
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 102 255 5.0E-17
sp|O54834|RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus GN=Arhgap6 PE=1 SV=3 803 1015 5.0E-17
sp|O43182|RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens GN=ARHGAP6 PE=1 SV=3 828 1015 7.0E-17
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 102 256 1.0E-16
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 102 255 2.0E-16
sp|Q8N392|RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens GN=ARHGAP18 PE=1 SV=3 770 978 4.0E-16
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 102 223 5.0E-16
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 102 255 1.0E-15
sp|Q923Q2|STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus GN=Stard13 PE=1 SV=5 762 978 2.0E-15
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 102 312 3.0E-15
sp|Q9Y3M8|STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens GN=STARD13 PE=1 SV=2 762 978 3.0E-15
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 102 252 2.0E-14
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 101 255 9.0E-14
sp|P55194|3BP1_MOUSE SH3 domain-binding protein 1 OS=Mus musculus GN=Sh3bp1 PE=1 SV=2 848 1008 9.0E-14
sp|Q9P2N2|RHG28_HUMAN Rho GTPase-activating protein 28 OS=Homo sapiens GN=ARHGAP28 PE=1 SV=3 770 1045 1.0E-13
sp|Q6PAJ1|BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus GN=Bcr PE=1 SV=3 798 1011 1.0E-13
sp|P11274|BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 798 1011 1.0E-13
sp|Q8BN58|RHG28_MOUSE Rho GTPase-activating protein 28 OS=Mus musculus GN=Arhgap28 PE=1 SV=1 770 1045 2.0E-13
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 102 253 2.0E-13
sp|Q5SSM3|RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus GN=Arhgap44 PE=1 SV=1 799 1002 2.0E-13
sp|Q80Y19|RHGBA_MOUSE Rho GTPase-activating protein 11A OS=Mus musculus GN=Arhgap11a PE=1 SV=2 799 1036 2.0E-13
sp|Q6P4F7|RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens GN=ARHGAP11A PE=1 SV=2 802 1016 2.0E-13
sp|F1LQX4|RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus GN=Arhgap44 PE=1 SV=2 799 1002 2.0E-13
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 99 254 3.0E-13
sp|Q8N103|TAGAP_HUMAN T-cell activation Rho GTPase-activating protein OS=Homo sapiens GN=TAGAP PE=1 SV=1 799 1009 3.0E-13
sp|Q68EM7|RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens GN=ARHGAP17 PE=1 SV=1 799 1002 4.0E-13
sp|Q17R89|RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens GN=ARHGAP44 PE=1 SV=1 799 1002 4.0E-13
sp|Q99N37|RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus GN=Arhgap17 PE=1 SV=1 799 978 5.0E-13
sp|Q3UIA2|RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus GN=Arhgap17 PE=1 SV=1 799 978 5.0E-13
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 800 978 6.0E-13
sp|Q8K031|STAR8_MOUSE StAR-related lipid transfer protein 8 OS=Mus musculus GN=Stard8 PE=1 SV=2 718 1023 7.0E-13
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 817 991 9.0E-13
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 102 223 1.0E-12
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 102 223 1.0E-12
sp|A4II46|ABR_XENTR Active breakpoint cluster region-related protein OS=Xenopus tropicalis GN=abr PE=2 SV=1 798 978 1.0E-12
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 88 241 1.0E-12
sp|Q8AVG0|ABR_XENLA Active breakpoint cluster region-related protein OS=Xenopus laevis GN=abr PE=2 SV=1 798 978 1.0E-12
sp|Q5SSL4|ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus GN=Abr PE=1 SV=1 798 978 2.0E-12
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 81 255 2.0E-12
sp|Q3KRB8|RHGBB_HUMAN Rho GTPase-activating protein 11B OS=Homo sapiens GN=ARHGAP11B PE=2 SV=1 802 991 2.0E-12
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 817 991 2.0E-12
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 793 1008 2.0E-12
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 803 989 2.0E-12
sp|A6QNS3|ABR_BOVIN Active breakpoint cluster region-related protein OS=Bos taurus GN=ABR PE=2 SV=1 798 978 2.0E-12
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 102 222 3.0E-12
sp|Q9Y3L3|3BP1_HUMAN SH3 domain-binding protein 1 OS=Homo sapiens GN=SH3BP1 PE=1 SV=3 802 1008 3.0E-12
sp|Q12979|ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens GN=ABR PE=2 SV=2 798 978 3.0E-12
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 803 989 3.0E-12
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 102 255 3.0E-12
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 91 220 4.0E-12
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 81 255 4.0E-12
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 102 255 4.0E-12
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 102 254 4.0E-12
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 102 252 5.0E-12
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 49 255 5.0E-12
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 96 255 5.0E-12
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 102 215 5.0E-12
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 102 277 6.0E-12
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 96 255 6.0E-12
sp|Q6REY9|RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus GN=Arhgap20 PE=1 SV=2 802 1019 6.0E-12
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 59 254 7.0E-12
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 829 989 7.0E-12
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 96 255 8.0E-12
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 102 255 9.0E-12
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 102 224 1.0E-11
sp|Q92502|STAR8_HUMAN StAR-related lipid transfer protein 8 OS=Homo sapiens GN=STARD8 PE=1 SV=2 701 1023 1.0E-11
sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 801 1043 1.0E-11
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 793 1008 1.0E-11
sp|Q6Y5D8|RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus GN=Arhgap10 PE=1 SV=2 799 1008 1.0E-11
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 102 223 2.0E-11
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 102 223 2.0E-11
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 101 217 2.0E-11
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 101 218 2.0E-11
sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 102 254 2.0E-11
sp|Q54FF4|GACL_DICDI Rho GTPase-activating protein gacL OS=Dictyostelium discoideum GN=gacL PE=2 SV=1 802 985 2.0E-11
sp|Q6IFT4|RHG20_MOUSE Rho GTPase-activating protein 20 OS=Mus musculus GN=Arhgap20 PE=1 SV=1 802 1021 2.0E-11
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 102 255 2.0E-11
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 102 222 3.0E-11
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 89 213 3.0E-11
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 89 213 3.0E-11
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 793 1008 3.0E-11
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 817 1008 3.0E-11
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 96 255 3.0E-11
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 829 1031 3.0E-11
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 827 1003 3.0E-11
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 102 214 4.0E-11
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 102 222 4.0E-11
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 102 214 4.0E-11
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 101 223 4.0E-11
sp|Q62172|RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus GN=Ralbp1 PE=1 SV=4 800 977 4.0E-11
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 102 214 5.0E-11
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 102 252 5.0E-11
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 99 213 5.0E-11
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 817 1008 5.0E-11
sp|Q559A0|GACU_DICDI Rho GTPase-activating protein gacU OS=Dictyostelium discoideum GN=gacU PE=3 SV=1 798 978 5.0E-11
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 102 223 6.0E-11
sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens GN=ARHGAP10 PE=1 SV=1 831 1012 7.0E-11
sp|O94988|FA13A_HUMAN Protein FAM13A OS=Homo sapiens GN=FAM13A PE=1 SV=2 792 981 7.0E-11
sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 50 254 7.0E-11
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 102 223 8.0E-11
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 102 254 8.0E-11
sp|Q08DP6|RHG10_BOVIN Rho GTPase-activating protein 10 OS=Bos taurus GN=ARHGAP10 PE=2 SV=1 799 1012 8.0E-11
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 99 213 1.0E-10
sp|Q54YV1|GACII_DICDI Rho GTPase-activating protein gacII OS=Dictyostelium discoideum GN=gacII PE=3 SV=1 848 978 1.0E-10
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 102 254 1.0E-10
sp|Q71FD7|FBLI1_MOUSE Filamin-binding LIM protein 1 OS=Mus musculus GN=Fblim1 PE=1 SV=2 62 254 1.0E-10
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 829 1002 1.0E-10
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 102 222 1.0E-10
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 99 213 2.0E-10
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 819 1002 2.0E-10
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 165 254 2.0E-10
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 829 1002 2.0E-10
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 829 978 2.0E-10
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 798 1005 2.0E-10
sp|Q9U3F4|ZYX_CAEEL Zyxin OS=Caenorhabditis elegans GN=zyx-1 PE=1 SV=1 98 254 2.0E-10
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 102 254 3.0E-10
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 102 222 3.0E-10
sp|Q9P2F6|RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens GN=ARHGAP20 PE=1 SV=2 802 1009 3.0E-10
sp|Q9WVM1|RGAP1_MOUSE Rac GTPase-activating protein 1 OS=Mus musculus GN=Racgap1 PE=1 SV=1 820 1014 3.0E-10
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 800 977 3.0E-10
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 91 214 3.0E-10
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 96 254 3.0E-10
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 793 978 3.0E-10
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 829 978 3.0E-10
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 99 254 3.0E-10
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 102 254 4.0E-10
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 102 234 4.0E-10
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 830 1002 4.0E-10
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 793 978 4.0E-10
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 102 222 4.0E-10
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 160 255 4.0E-10
sp|Q5U2Z2|AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus GN=Ajuba PE=1 SV=1 88 254 4.0E-10
sp|Q91XC0|AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus GN=Ajuba PE=1 SV=1 88 254 4.0E-10
sp|E1BKA3|AJUBA_BOVIN LIM domain-containing protein ajuba OS=Bos taurus GN=AJUBA PE=3 SV=1 59 254 4.0E-10
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 165 254 6.0E-10
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 800 1002 6.0E-10
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 97 255 8.0E-10
sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=1 SV=2 801 1007 8.0E-10
sp|Q5FWK3|RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus GN=Arhgap1 PE=1 SV=1 803 989 8.0E-10
sp|Q9V9S7|SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster GN=RhoGAP100F PE=1 SV=2 802 978 1.0E-09
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 102 254 1.0E-09
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 102 254 1.0E-09
sp|Q9PT60|RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis GN=ralbp1-a PE=1 SV=3 800 977 1.0E-09
sp|Q96IF1|AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens GN=AJUBA PE=1 SV=1 72 254 1.0E-09
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 102 254 1.0E-09
sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens GN=RACGAP1 PE=1 SV=1 820 986 1.0E-09
sp|A7MB27|RHG36_BOVIN Rho GTPase-activating protein 36 OS=Bos taurus GN=ARHGAP36 PE=2 SV=1 815 1015 1.0E-09
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 160 255 2.0E-09
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 817 981 2.0E-09
sp|B5DFQ4|RHG26_XENTR Rho GTPase-activating protein 26 OS=Xenopus tropicalis GN=arhgap26 PE=2 SV=1 814 1015 2.0E-09
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 121 258 2.0E-09
sp|Q5REN1|FBLI1_PONAB Filamin-binding LIM protein 1 OS=Pongo abelii GN=FBLIM1 PE=2 SV=1 114 254 2.0E-09
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 102 258 2.0E-09
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 165 254 3.0E-09
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 91 214 3.0E-09
sp|Q8BRH3|RHG19_MOUSE Rho GTPase-activating protein 19 OS=Mus musculus GN=Arhgap19 PE=1 SV=2 766 1015 3.0E-09
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 85 255 3.0E-09
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 800 977 3.0E-09
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 817 981 3.0E-09
sp|Q5U4T3|RHG26_XENLA Rho GTPase-activating protein 26 OS=Xenopus laevis GN=arhgap26 PE=2 SV=1 814 1015 3.0E-09
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 55 255 4.0E-09
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 49 255 4.0E-09
sp|Q8WUP2|FBLI1_HUMAN Filamin-binding LIM protein 1 OS=Homo sapiens GN=FBLIM1 PE=1 SV=2 114 254 4.0E-09
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 816 981 4.0E-09
sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=1 SV=2 825 1007 4.0E-09
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 102 255 4.0E-09
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 755 978 4.0E-09
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 829 978 4.0E-09
sp|Q8IR79|LIMK1_DROME LIM domain kinase 1 OS=Drosophila melanogaster GN=LIMK1 PE=1 SV=1 97 224 4.0E-09
sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 120 258 5.0E-09
sp|Q20498|RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans GN=rrc-1 PE=1 SV=3 772 1004 6.0E-09
sp|Q1JQB5|FBLI1_BOVIN Filamin-binding LIM protein 1 OS=Bos taurus GN=FBLIM1 PE=2 SV=1 114 254 6.0E-09
sp|P53412|LHX3_CHICK LIM/homeobox protein Lhx3 OS=Gallus gallus GN=LHX3 PE=2 SV=1 95 220 6.0E-09
sp|P53671|LIMK2_HUMAN LIM domain kinase 2 OS=Homo sapiens GN=LIMK2 PE=1 SV=1 99 227 6.0E-09
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 102 253 7.0E-09
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 165 255 7.0E-09
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 799 1008 8.0E-09
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 102 253 9.0E-09
sp|P53670|LIMK2_RAT LIM domain kinase 2 OS=Rattus norvegicus GN=Limk2 PE=2 SV=1 102 227 9.0E-09
sp|P53666|LIMK2_CHICK LIM domain kinase 2 OS=Gallus gallus GN=LIMK2 PE=2 SV=1 99 227 9.0E-09
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 102 252 1.0E-08
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 102 220 1.0E-08
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 102 233 1.0E-08
sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 799 1005 1.0E-08
sp|Q9VTU3|RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster GN=RhoGAP68F PE=1 SV=1 803 1011 1.0E-08
sp|Q5F3G0|RHG19_CHICK Rho GTPase-activating protein 19 OS=Gallus gallus GN=ARHGAP19 PE=2 SV=1 798 1015 1.0E-08
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 102 238 2.0E-08
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 102 277 2.0E-08
sp|O54785|LIMK2_MOUSE LIM domain kinase 2 OS=Mus musculus GN=Limk2 PE=1 SV=2 102 227 2.0E-08
sp|O70433|FHL2_MOUSE Four and a half LIM domains protein 2 OS=Mus musculus GN=Fhl2 PE=1 SV=1 120 258 2.0E-08
sp|Q6ZW31|SYDE1_HUMAN Rho GTPase-activating protein SYDE1 OS=Homo sapiens GN=SYDE1 PE=1 SV=1 802 978 2.0E-08
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 801 978 2.0E-08
sp|Q25132|LHX3_HALRO LIM/homeobox protein Lhx3 OS=Halocynthia roretzi GN=LHX3 PE=2 SV=2 77 251 2.0E-08
sp|O74398|YOCC_SCHPO LIM domain-containing protein C4F6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.12 PE=1 SV=1 42 254 2.0E-08
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 788 1003 2.0E-08
sp|Q6ZRI8|RHG36_HUMAN Rho GTPase-activating protein 36 OS=Homo sapiens GN=ARHGAP36 PE=2 SV=1 815 1015 2.0E-08
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 788 947 2.0E-08
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 102 254 2.0E-08
sp|Q96P48|ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ARAP1 PE=1 SV=3 734 978 2.0E-08
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 102 238 3.0E-08
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 102 252 3.0E-08
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 780 978 3.0E-08
sp|Q90421|LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio GN=lhx3 PE=2 SV=1 99 220 3.0E-08
sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 788 978 3.0E-08
sp|E9Q6X9|RHG40_MOUSE Rho GTPase-activating protein 40 OS=Mus musculus GN=Arhgap40 PE=3 SV=1 801 987 3.0E-08
sp|Q14192|FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens GN=FHL2 PE=1 SV=3 120 258 3.0E-08
sp|Q86IG9|GACH_DICDI Rho GTPase-activating protein gacH OS=Dictyostelium discoideum GN=gacH PE=3 SV=1 845 1003 3.0E-08
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 102 238 4.0E-08
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 165 255 4.0E-08
sp|Q4LDD4|ARAP1_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Arap1 PE=1 SV=2 734 978 4.0E-08
sp|P50481|LHX3_MOUSE LIM/homeobox protein Lhx3 OS=Mus musculus GN=Lhx3 PE=1 SV=1 95 220 4.0E-08
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 165 350 5.0E-08
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 165 255 5.0E-08
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 102 254 6.0E-08
sp|Q54SL6|GACQ_DICDI Rho GTPase-activating protein gacQ OS=Dictyostelium discoideum GN=gacQ PE=3 SV=1 800 975 6.0E-08
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 787 1005 6.0E-08
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 99 218 7.0E-08
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 102 254 7.0E-08
sp|O43295|SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens GN=SRGAP3 PE=1 SV=3 829 1015 7.0E-08
sp|Q90Z06|PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis GN=prickle1-a PE=1 SV=1 101 250 7.0E-08
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 795 1002 7.0E-08
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 99 218 8.0E-08
sp|Q9VIS1|CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster GN=CdGAPr PE=1 SV=2 847 998 8.0E-08
sp|Q13642|FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens GN=FHL1 PE=1 SV=4 102 233 9.0E-08
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 163 254 1.0E-07
sp|Q9UNA1|RHG26_HUMAN Rho GTPase-activating protein 26 OS=Homo sapiens GN=ARHGAP26 PE=1 SV=1 812 1017 1.0E-07
sp|Q9UBR4|LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens GN=LHX3 PE=1 SV=2 99 220 1.0E-07
sp|Q91Z67|SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus GN=Srgap2 PE=1 SV=2 829 1035 1.0E-07
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 793 978 1.0E-07
sp|Q6AYC5|RHG15_RAT Rho GTPase-activating protein 15 OS=Rattus norvegicus GN=Arhgap15 PE=1 SV=1 788 984 1.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 832 993 1.0E-07
sp|Q54GD0|MGP1_DICDI Mental retardation GTPase activating protein homolog 1 OS=Dictyostelium discoideum GN=mgp1 PE=3 SV=1 797 1000 1.0E-07
sp|O97581|LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa GN=LHX3 PE=2 SV=1 99 220 1.0E-07
sp|Q5ZMW5|RHG26_CHICK Rho GTPase-activating protein 26 OS=Gallus gallus GN=ARHGAP26 PE=1 SV=2 814 1008 1.0E-07
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 102 206 2.0E-07
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 102 206 2.0E-07
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 99 218 2.0E-07
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 99 218 2.0E-07
sp|Q6ZQ82|RHG26_MOUSE Rho GTPase-activating protein 26 OS=Mus musculus GN=Arhgap26 PE=1 SV=3 812 1017 2.0E-07
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 794 1002 2.0E-07
sp|Q9C0H5|RHG39_HUMAN Rho GTPase-activating protein 39 OS=Homo sapiens GN=ARHGAP39 PE=1 SV=2 847 978 2.0E-07
sp|P42331|RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens GN=ARHGAP25 PE=1 SV=2 801 1002 2.0E-07
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 828 978 2.0E-07
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 828 978 2.0E-07
sp|Q14CB8|RHG19_HUMAN Rho GTPase-activating protein 19 OS=Homo sapiens GN=ARHGAP19 PE=1 SV=1 798 978 2.0E-07
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 793 978 2.0E-07
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 88 229 2.0E-07
sp|D2H9U0|RHG36_AILME Rho GTPase-activating protein 36 OS=Ailuropoda melanoleuca GN=ARHGAP36 PE=3 SV=1 815 1015 2.0E-07
sp|P59281|RHG39_MOUSE Rho GTPase-activating protein 39 OS=Mus musculus GN=Arhgap39 PE=1 SV=2 847 978 2.0E-07
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 102 222 3.0E-07
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 99 221 3.0E-07
sp|Q9CXP4|RHG08_MOUSE Rho GTPase-activating protein 8 OS=Mus musculus GN=Arhgap8 PE=2 SV=3 829 978 3.0E-07
sp|Q1LWV4|LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio GN=lhx9 PE=2 SV=1 38 220 3.0E-07
sp|Q8R5G7|ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Arap3 PE=1 SV=3 829 978 3.0E-07
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 93 254 3.0E-07
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 98 254 3.0E-07
sp|P36200|LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis GN=lhx3 PE=1 SV=1 99 220 3.0E-07
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 102 220 4.0E-07
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 102 217 4.0E-07
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 99 221 4.0E-07
sp|Q640N3|RHG30_MOUSE Rho GTPase-activating protein 30 OS=Mus musculus GN=Arhgap30 PE=1 SV=3 847 1005 4.0E-07
sp|D4A208|SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus GN=Srgap2 PE=1 SV=1 829 1035 4.0E-07
sp|O75044|SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens GN=SRGAP2 PE=1 SV=2 829 1015 4.0E-07
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 98 254 4.0E-07
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 102 254 4.0E-07
sp|Q5XI07|LPP_RAT Lipoma-preferred partner homolog OS=Rattus norvegicus GN=Lpp PE=1 SV=1 102 254 4.0E-07
sp|Q61CA4|SYD1_CAEBR Rho GTPase-activating protein syd-1 OS=Caenorhabditis briggsae GN=syd-1 PE=3 SV=2 782 947 5.0E-07
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 788 984 5.0E-07
sp|Q90WV2|PRI1B_XENLA Prickle-like protein 1-B OS=Xenopus laevis GN=prickle1-b PE=2 SV=2 102 250 5.0E-07
sp|P53776|LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus GN=Lhx4 PE=1 SV=4 98 220 6.0E-07
sp|Q969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens GN=LHX4 PE=1 SV=2 98 220 6.0E-07
sp|Q8WWN8|ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ARAP3 PE=1 SV=1 829 978 6.0E-07
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 99 214 7.0E-07
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 102 218 7.0E-07
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 93 254 8.0E-07
sp|P85298|RHG08_HUMAN Rho GTPase-activating protein 8 OS=Homo sapiens GN=ARHGAP8 PE=1 SV=1 829 1012 8.0E-07
sp|Q54WY8|GACN_DICDI Rho GTPase-activating protein gacN OS=Dictyostelium discoideum GN=gacN PE=3 SV=1 845 978 8.0E-07
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 767 1002 9.0E-07
sp|Q9DBZ9|SYDE1_MOUSE Rho GTPase-activating protein SYDE1 OS=Mus musculus GN=Syde1 PE=1 SV=1 802 999 9.0E-07
sp|Q32L23|LIMK2_BOVIN LIM domain kinase 2 OS=Bos taurus GN=LIMK2 PE=2 SV=1 102 227 9.0E-07
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 98 209 1.0E-06
sp|Q13642|FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens GN=FHL1 PE=1 SV=4 94 255 1.0E-06
sp|Q80W90|LHX9_RAT LIM/homeobox protein Lhx9 OS=Rattus norvegicus GN=Lhx9 PE=2 SV=1 102 220 1.0E-06
sp|P20154|LIN11_CAEEL Protein lin-11 OS=Caenorhabditis elegans GN=lin-11 PE=1 SV=2 102 220 1.0E-06
sp|Q9NQ69|LHX9_HUMAN LIM/homeobox protein Lhx9 OS=Homo sapiens GN=LHX9 PE=1 SV=3 102 220 1.0E-06
sp|Q54XT6|GACR_DICDI Rho GTPase-activating protein gacR OS=Dictyostelium discoideum GN=gacR PE=3 SV=1 802 978 1.0E-06
sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 98 254 1.0E-06
sp|B2RWW0|TAGAP_MOUSE T-cell activation Rho GTPase-activating protein OS=Mus musculus GN=Tagap PE=2 SV=2 799 982 1.0E-06
sp|Q9WUH2|LHX9_MOUSE LIM/homeobox protein Lhx9 OS=Mus musculus GN=Lhx9 PE=1 SV=3 102 220 1.0E-06
sp|A0JNI8|LHX9_BOVIN LIM/homeobox protein Lhx9 OS=Bos taurus GN=LHX9 PE=2 SV=2 102 220 1.0E-06
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 91 254 2.0E-06
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 98 217 2.0E-06
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 98 217 2.0E-06
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 98 217 2.0E-06
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 96 209 2.0E-06
sp|Q8BFW7|LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus GN=Lpp PE=1 SV=1 102 254 2.0E-06
sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans GN=tag-325 PE=3 SV=1 752 980 2.0E-06
sp|Q8BYW1|RHG25_MOUSE Rho GTPase-activating protein 25 OS=Mus musculus GN=Arhgap25 PE=1 SV=2 801 1002 2.0E-06
sp|Q2YDK0|FHL5_BOVIN Four and a half LIM domains protein 5 OS=Bos taurus GN=FHL5 PE=2 SV=1 121 254 2.0E-06
sp|Q9Z1Y4|TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus GN=Trip6 PE=1 SV=1 102 236 2.0E-06
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 102 217 3.0E-06
sp|A7YY57|RHG29_BOVIN Rho GTPase-activating protein 29 OS=Bos taurus GN=ARHGAP29 PE=2 SV=1 829 985 3.0E-06
sp|Q54QF4|MGP4_DICDI Mental retardation GTPase activating protein homolog 4 OS=Dictyostelium discoideum GN=mgp4 PE=3 SV=1 802 978 3.0E-06
sp|P83509|RHG35_CANLF Rho GTPase-activating protein 35 OS=Canis lupus familiaris GN=ARHGAP35 PE=2 SV=1 803 979 3.0E-06
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 102 236 3.0E-06
sp|Q9U1I1|ESN_DROME Protein espinas OS=Drosophila melanogaster GN=esn PE=2 SV=1 100 250 3.0E-06
sp|B7ZUL2|LIMD1_XENTR LIM domain-containing protein 1 OS=Xenopus tropicalis GN=limd1 PE=2 SV=1 92 254 3.0E-06
sp|Q54BP9|GACV_DICDI Rho GTPase-activating protein gacV OS=Dictyostelium discoideum GN=gacV PE=3 SV=1 801 905 3.0E-06
sp|B2RQE8|RHG42_MOUSE Rho GTPase-activating protein 42 OS=Mus musculus GN=Arhgap42 PE=1 SV=1 889 1008 3.0E-06
sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 86 258 3.0E-06
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 98 217 4.0E-06
sp|Q9WTX7|FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus GN=Fhl5 PE=1 SV=1 102 255 4.0E-06
sp|Q13643|FHL3_HUMAN Four and a half LIM domains protein 3 OS=Homo sapiens GN=FHL3 PE=1 SV=4 102 254 4.0E-06
sp|Q6INE5|RHG19_XENLA Rho GTPase-activating protein 19 OS=Xenopus laevis GN=arhgap19 PE=2 SV=1 766 1015 4.0E-06
sp|A6NI28|RHG42_HUMAN Rho GTPase-activating protein 42 OS=Homo sapiens GN=ARHGAP42 PE=1 SV=3 889 1008 5.0E-06
sp|Q4R7A4|FHL5_MACFA Four and a half LIM domains protein 5 OS=Macaca fascicularis GN=FHL5 PE=2 SV=1 121 254 5.0E-06
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 102 236 5.0E-06
sp|Q5TD97|FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens GN=FHL5 PE=1 SV=1 121 254 5.0E-06
sp|Q9WTX7|FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus GN=Fhl5 PE=1 SV=1 121 254 6.0E-06
sp|Q6AXT1|FHL5_RAT Four and a half LIM domains protein 5 OS=Rattus norvegicus GN=Fhl5 PE=2 SV=1 121 254 6.0E-06
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 102 255 7.0E-06
sp|Q5TD97|FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens GN=FHL5 PE=1 SV=1 102 255 7.0E-06
sp|Q924W9|RBTN1_MOUSE Rhombotin-1 OS=Mus musculus GN=Lmo1 PE=2 SV=1 92 218 8.0E-06
sp|Q9Z0S2|LHX2_MOUSE LIM/homeobox protein Lhx2 OS=Mus musculus GN=Lhx2 PE=1 SV=1 102 218 8.0E-06
sp|P53409|ISL3_ONCTS Insulin gene enhancer protein ISL-3 OS=Oncorhynchus tshawytscha GN=isl3 PE=2 SV=1 87 219 8.0E-06
sp|P50458|LHX2_HUMAN LIM/homeobox protein Lhx2 OS=Homo sapiens GN=LHX2 PE=2 SV=2 102 218 8.0E-06
sp|Q3B8H4|RBTN1_XENLA Rhombotin-1 OS=Xenopus laevis GN=lmo1 PE=2 SV=1 81 218 8.0E-06
sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 98 255 9.0E-06
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 102 236 9.0E-06
sp|Q8JFQ2|RBTN1_DANRE Rhombotin-1 OS=Danio rerio GN=lmo1 PE=2 SV=1 92 218 9.0E-06
sp|A2I8Z7|LHX9_ASTFA LIM/homeobox protein Lhx9 OS=Astyanax fasciatus GN=lhx9 PE=2 SV=1 102 220 9.0E-06
sp|P25800|RBTN1_HUMAN Rhombotin-1 OS=Homo sapiens GN=LMO1 PE=1 SV=1 92 218 9.0E-06
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 88 254 1.0E-05
sp|Q0P5B3|RBTN1_BOVIN Rhombotin-1 OS=Bos taurus GN=LMO1 PE=2 SV=1 92 218 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1845
MTSDQDLSGDCSRGDYPDDRSGPDSAHAFGDRNRQNGGSKTPDNSHHLRPSPAGSGPASNSASSSGLSGPSPPGA
WPSDDVQPRKSGEMSRSRQRNGHVRTCNKCGEPLTGQFVRALDGTFHLDCFKCRDCGQIVASKFFPADNDDGNGQ
YPLCETDYFGRLGLLCYKCGGALRGSYITALDRKYHIEHFTCSLCPTVFGAQDSYYEHDGNIYCHYHYSTRFAQK
CNGCQTAILKQFVEIYRNGQDQHWHPECYMIHKFWNVRLAQPVETAQTEAAHDFKSDAVNEKQIRQGEEHMEDKV
YRIWSVLSTFEESSAACISDMLLHVSNGAYVDGVLVAKRFIWHVEVLFQSADRLDKTVQACSDKGMSYGREAKLL
CKKIVAFFSLLSKTQDTSVRKLGVTQELLSLVTGLAHYLKLLIRICLQAALRLERLTGNSDGIHQLLTDLADFET
YKTDESLLQITMGGAKLSTKDSDHCVVCTRSVEDECAKSGDYRWHIGCVNCSRCSRELGRSLEEARLNPYDGKIY
CTRCLAPKRDDMATFEHVSKLQQYAFLLKVALARLLDILRNNGALPNTSAESSIVQGGEESSRLEADRHRESTYE
NTLNEVRRLRSTRLDRHLASSVRQARTSRVMDADGQGPLPDLSGTGQGEAEGQAPSDLMFGQNDAITLDDIPRIV
AAEQSREQQQQQRNSNLRQDLIRSPASEPGRVAGHQRTQSASRDPDVRAANGAPCRLTRKFFPELSGLEYFNVRH
LAVLTMQPMVEQEFALEELLGLIESRKPPTFWKNLGKAFKNDKNRNVKKKGVFGVPLDVIIERDGADSTDGVGPG
TLRIPVVVEDIISSMRKMDLSVEGVFRKNGNIKKQQEMVDKINAEGCDVVNFMEQPVVQLAALLKRYLRDLPDPL
MTHKLYRLWVSAAKMTDPERRKQCLHLTCCLLPKSHRDCLEILFSFLKWAGSFHQVDEEIGSKMDIRNLATVIAP
NVLTNPNKAPALDSEAIFIIDAVETLIANIEDMCQVPTEILTLLNDPYLFSNNGETTTKEILRRFQDRREQIPAA
DVTEVFNRQDTSTRSPPRRVETDPSVWQGERSVRPVQESVMAQPVSSGQGSSGQRQWTGAGERPLPYNQRFNHSD
SHLENSELNQRGEWRNSAWGRRGGGVGVGNS*
Coding >OphauB2|1845
ATGACTTCGGACCAAGACTTGAGCGGCGACTGCTCTCGCGGCGACTACCCCGATGATCGGTCGGGTCCTGACTCG
GCCCACGCTTTTGGAGATAGGAACCGACAGAATGGAGGAAGCAAGACACCCGACAACTCGCATCATCTCAGACCC
AGTCCTGCAGGCTCTGGTCCCGCCTCAAACTCTGCGTCCAGCTCTGGTCTCTCTGGACCATCCCCGCCTGGCGCG
TGGCCTTCGGATGACGTGCAGCCGCGCAAAAGCGGAGAGATGAGTCGATCGCGACAGAGAAACGGCCATGTGCGC
ACCTGCAATAAGTGTGGCGAGCCGTTGACGGGCCAGTTTGTCCGTGCCCTCGATGGTACTTTTCACCTCGACTGC
TTCAAGTGCCGGGACTGTGGTCAAATCGTAGCTTCCAAATTCTTTCCTGCCGACAACGACGACGGAAACGGCCAA
TACCCGCTCTGTGAAACCGACTACTTTGGACGACTAGGCTTGCTTTGCTACAAATGTGGCGGTGCGCTCAGGGGA
TCCTATATTACAGCTCTGGACAGAAAATATCACATTGAACATTTCACCTGTTCTCTCTGTCCCACCGTGTTTGGC
GCCCAGGATAGCTACTACGAGCACGATGGCAATATCTACTGCCATTATCATTACTCAACGCGCTTTGCCCAGAAA
TGCAATGGCTGCCAGACGGCCATTTTGAAGCAGTTTGTCGAAATCTACCGAAACGGCCAAGACCAGCACTGGCAC
CCTGAATGCTACATGATACACAAGTTCTGGAATGTGCGTTTGGCACAGCCTGTAGAGACGGCACAGACAGAAGCG
GCGCATGACTTCAAATCGGATGCCGTCAATGAAAAACAGATTCGCCAGGGCGAGGAGCACATGGAGGACAAGGTC
TACCGCATATGGAGCGTCCTCTCCACCTTTGAAGAATCATCGGCGGCTTGCATCTCGGACATGCTCTTGCACGTT
AGCAACGGCGCCTACGTCGACGGCGTCCTGGTGGCTAAGCGCTTCATATGGCACGTTGAAGTCTTGTTTCAGTCT
GCCGACCGGCTAGACAAGACGGTGCAAGCGTGCAGCGATAAAGGCATGTCGTACGGACGGGAAGCCAAGCTTTTA
TGCAAAAAAATCGTGGCTTTTTTCTCCCTCTTGTCCAAGACACAGGATACCAGCGTCAGAAAGCTCGGCGTCACA
CAAGAGCTCCTATCCTTGGTGACTGGCTTGGCGCATTATCTCAAACTCTTGATACGCATCTGCCTCCAAGCCGCC
TTGCGCTTGGAGCGACTGACGGGAAATAGCGATGGAATTCATCAATTGCTCACGGATCTGGCTGATTTTGAAACT
TATAAGACGGACGAGAGCCTTCTGCAAATCACCATGGGCGGCGCCAAGCTATCAACCAAAGACTCGGATCACTGC
GTTGTCTGCACCAGATCTGTGGAAGATGAGTGCGCCAAGAGCGGAGACTACAGGTGGCACATTGGCTGTGTCAAT
TGTTCGCGCTGTTCACGAGAGCTGGGACGGAGTCTGGAAGAAGCGCGTCTAAATCCTTATGACGGCAAGATATAC
TGCACTAGGTGTTTGGCCCCCAAACGAGACGACATGGCCACGTTTGAGCACGTTAGCAAGCTTCAGCAGTATGCC
TTTCTCCTCAAGGTGGCACTGGCACGGCTATTGGATATTCTCCGCAACAATGGCGCCCTGCCCAACACATCGGCA
GAATCAAGCATCGTCCAAGGCGGAGAGGAAAGTAGCAGGCTCGAAGCAGACCGACATCGCGAATCAACATATGAG
AACACGTTGAACGAAGTTCGTAGGTTGCGAAGCACACGGCTGGATCGTCATCTTGCCTCGAGTGTCCGACAGGCA
CGGACATCTCGTGTAATGGATGCAGACGGCCAAGGTCCGCTCCCCGACTTGTCTGGGACTGGCCAAGGCGAAGCA
GAAGGACAAGCACCATCGGATCTCATGTTTGGGCAGAACGACGCCATTACGCTTGATGATATTCCACGCATAGTT
GCTGCTGAGCAGTCGCGCGAGCAGCAGCAGCAACAACGCAATAGTAACTTGCGACAGGACCTCATCAGGTCACCC
GCCTCTGAGCCAGGAAGAGTTGCAGGACATCAACGGACACAGTCGGCATCTAGAGACCCCGATGTTCGCGCAGCC
AATGGCGCCCCTTGTCGGCTAACGCGCAAGTTCTTCCCAGAGCTTTCGGGACTCGAGTACTTCAACGTGCGGCAT
CTGGCCGTCTTGACAATGCAGCCCATGGTGGAGCAAGAGTTTGCGCTTGAGGAGCTTCTTGGCTTGATTGAGTCT
CGGAAGCCCCCTACGTTTTGGAAAAATCTCGGCAAGGCATTCAAGAATGACAAGAATAGGAATGTCAAGAAGAAG
GGAGTCTTTGGCGTGCCGCTCGACGTGATTATTGAGCGTGACGGAGCAGATTCGACTGACGGCGTTGGCCCGGGA
ACTCTACGTATTCCAGTCGTTGTGGAAGACATCATTTCATCGATGCGCAAGATGGACCTTTCAGTTGAGGGCGTC
TTCCGCAAGAATGGCAACATCAAGAAGCAACAGGAAATGGTGGACAAGATCAATGCCGAAGGATGCGACGTGGTC
AACTTCATGGAGCAGCCCGTGGTGCAGTTGGCGGCGCTCCTCAAGCGATATCTGCGCGACTTGCCGGATCCGTTG
ATGACGCACAAGCTGTACCGACTGTGGGTGAGTGCGGCAAAAATGACGGATCCTGAAAGGCGGAAACAGTGTCTG
CACTTGACGTGCTGCTTGCTGCCCAAGAGCCACCGTGATTGCCTCGAGATTCTCTTTAGTTTTTTGAAATGGGCC
GGCTCCTTCCACCAGGTTGACGAAGAGATTGGCTCCAAGATGGACATTCGCAATTTGGCCACTGTGATAGCTCCA
AATGTCTTGACAAATCCCAACAAGGCCCCGGCCCTAGACAGCGAAGCTATATTCATCATCGATGCCGTCGAGACG
CTCATTGCCAATATCGAGGACATGTGTCAGGTTCCCACTGAAATATTGACGCTACTAAACGACCCCTATTTGTTT
AGTAACAATGGCGAAACGACGACCAAGGAGATTCTCAGGCGGTTCCAGGACCGACGGGAACAGATTCCTGCAGCC
GACGTGACCGAGGTGTTTAATAGGCAGGACACTTCGACGCGGTCGCCGCCGCGGCGTGTTGAGACGGATCCATCA
GTCTGGCAGGGCGAGAGATCGGTGCGACCAGTTCAGGAGTCAGTCATGGCTCAGCCAGTCTCGTCGGGCCAGGGC
AGCTCGGGGCAGAGGCAATGGACAGGAGCCGGCGAGCGCCCATTACCGTACAACCAGCGATTCAACCATTCAGAC
AGCCATCTCGAAAACTCTGAGCTTAACCAGAGGGGCGAATGGCGCAACTCTGCCTGGGGCCGCCGTGGCGGAGGT
GTCGGCGTTGGCAACTCATGA
Transcript >OphauB2|1845
ATGACTTCGGACCAAGACTTGAGCGGCGACTGCTCTCGCGGCGACTACCCCGATGATCGGTCGGGTCCTGACTCG
GCCCACGCTTTTGGAGATAGGAACCGACAGAATGGAGGAAGCAAGACACCCGACAACTCGCATCATCTCAGACCC
AGTCCTGCAGGCTCTGGTCCCGCCTCAAACTCTGCGTCCAGCTCTGGTCTCTCTGGACCATCCCCGCCTGGCGCG
TGGCCTTCGGATGACGTGCAGCCGCGCAAAAGCGGAGAGATGAGTCGATCGCGACAGAGAAACGGCCATGTGCGC
ACCTGCAATAAGTGTGGCGAGCCGTTGACGGGCCAGTTTGTCCGTGCCCTCGATGGTACTTTTCACCTCGACTGC
TTCAAGTGCCGGGACTGTGGTCAAATCGTAGCTTCCAAATTCTTTCCTGCCGACAACGACGACGGAAACGGCCAA
TACCCGCTCTGTGAAACCGACTACTTTGGACGACTAGGCTTGCTTTGCTACAAATGTGGCGGTGCGCTCAGGGGA
TCCTATATTACAGCTCTGGACAGAAAATATCACATTGAACATTTCACCTGTTCTCTCTGTCCCACCGTGTTTGGC
GCCCAGGATAGCTACTACGAGCACGATGGCAATATCTACTGCCATTATCATTACTCAACGCGCTTTGCCCAGAAA
TGCAATGGCTGCCAGACGGCCATTTTGAAGCAGTTTGTCGAAATCTACCGAAACGGCCAAGACCAGCACTGGCAC
CCTGAATGCTACATGATACACAAGTTCTGGAATGTGCGTTTGGCACAGCCTGTAGAGACGGCACAGACAGAAGCG
GCGCATGACTTCAAATCGGATGCCGTCAATGAAAAACAGATTCGCCAGGGCGAGGAGCACATGGAGGACAAGGTC
TACCGCATATGGAGCGTCCTCTCCACCTTTGAAGAATCATCGGCGGCTTGCATCTCGGACATGCTCTTGCACGTT
AGCAACGGCGCCTACGTCGACGGCGTCCTGGTGGCTAAGCGCTTCATATGGCACGTTGAAGTCTTGTTTCAGTCT
GCCGACCGGCTAGACAAGACGGTGCAAGCGTGCAGCGATAAAGGCATGTCGTACGGACGGGAAGCCAAGCTTTTA
TGCAAAAAAATCGTGGCTTTTTTCTCCCTCTTGTCCAAGACACAGGATACCAGCGTCAGAAAGCTCGGCGTCACA
CAAGAGCTCCTATCCTTGGTGACTGGCTTGGCGCATTATCTCAAACTCTTGATACGCATCTGCCTCCAAGCCGCC
TTGCGCTTGGAGCGACTGACGGGAAATAGCGATGGAATTCATCAATTGCTCACGGATCTGGCTGATTTTGAAACT
TATAAGACGGACGAGAGCCTTCTGCAAATCACCATGGGCGGCGCCAAGCTATCAACCAAAGACTCGGATCACTGC
GTTGTCTGCACCAGATCTGTGGAAGATGAGTGCGCCAAGAGCGGAGACTACAGGTGGCACATTGGCTGTGTCAAT
TGTTCGCGCTGTTCACGAGAGCTGGGACGGAGTCTGGAAGAAGCGCGTCTAAATCCTTATGACGGCAAGATATAC
TGCACTAGGTGTTTGGCCCCCAAACGAGACGACATGGCCACGTTTGAGCACGTTAGCAAGCTTCAGCAGTATGCC
TTTCTCCTCAAGGTGGCACTGGCACGGCTATTGGATATTCTCCGCAACAATGGCGCCCTGCCCAACACATCGGCA
GAATCAAGCATCGTCCAAGGCGGAGAGGAAAGTAGCAGGCTCGAAGCAGACCGACATCGCGAATCAACATATGAG
AACACGTTGAACGAAGTTCGTAGGTTGCGAAGCACACGGCTGGATCGTCATCTTGCCTCGAGTGTCCGACAGGCA
CGGACATCTCGTGTAATGGATGCAGACGGCCAAGGTCCGCTCCCCGACTTGTCTGGGACTGGCCAAGGCGAAGCA
GAAGGACAAGCACCATCGGATCTCATGTTTGGGCAGAACGACGCCATTACGCTTGATGATATTCCACGCATAGTT
GCTGCTGAGCAGTCGCGCGAGCAGCAGCAGCAACAACGCAATAGTAACTTGCGACAGGACCTCATCAGGTCACCC
GCCTCTGAGCCAGGAAGAGTTGCAGGACATCAACGGACACAGTCGGCATCTAGAGACCCCGATGTTCGCGCAGCC
AATGGCGCCCCTTGTCGGCTAACGCGCAAGTTCTTCCCAGAGCTTTCGGGACTCGAGTACTTCAACGTGCGGCAT
CTGGCCGTCTTGACAATGCAGCCCATGGTGGAGCAAGAGTTTGCGCTTGAGGAGCTTCTTGGCTTGATTGAGTCT
CGGAAGCCCCCTACGTTTTGGAAAAATCTCGGCAAGGCATTCAAGAATGACAAGAATAGGAATGTCAAGAAGAAG
GGAGTCTTTGGCGTGCCGCTCGACGTGATTATTGAGCGTGACGGAGCAGATTCGACTGACGGCGTTGGCCCGGGA
ACTCTACGTATTCCAGTCGTTGTGGAAGACATCATTTCATCGATGCGCAAGATGGACCTTTCAGTTGAGGGCGTC
TTCCGCAAGAATGGCAACATCAAGAAGCAACAGGAAATGGTGGACAAGATCAATGCCGAAGGATGCGACGTGGTC
AACTTCATGGAGCAGCCCGTGGTGCAGTTGGCGGCGCTCCTCAAGCGATATCTGCGCGACTTGCCGGATCCGTTG
ATGACGCACAAGCTGTACCGACTGTGGGTGAGTGCGGCAAAAATGACGGATCCTGAAAGGCGGAAACAGTGTCTG
CACTTGACGTGCTGCTTGCTGCCCAAGAGCCACCGTGATTGCCTCGAGATTCTCTTTAGTTTTTTGAAATGGGCC
GGCTCCTTCCACCAGGTTGACGAAGAGATTGGCTCCAAGATGGACATTCGCAATTTGGCCACTGTGATAGCTCCA
AATGTCTTGACAAATCCCAACAAGGCCCCGGCCCTAGACAGCGAAGCTATATTCATCATCGATGCCGTCGAGACG
CTCATTGCCAATATCGAGGACATGTGTCAGGTTCCCACTGAAATATTGACGCTACTAAACGACCCCTATTTGTTT
AGTAACAATGGCGAAACGACGACCAAGGAGATTCTCAGGCGGTTCCAGGACCGACGGGAACAGATTCCTGCAGCC
GACGTGACCGAGGTGTTTAATAGGCAGGACACTTCGACGCGGTCGCCGCCGCGGCGTGTTGAGACGGATCCATCA
GTCTGGCAGGGCGAGAGATCGGTGCGACCAGTTCAGGAGTCAGTCATGGCTCAGCCAGTCTCGTCGGGCCAGGGC
AGCTCGGGGCAGAGGCAATGGACAGGAGCCGGCGAGCGCCCATTACCGTACAACCAGCGATTCAACCATTCAGAC
AGCCATCTCGAAAACTCTGAGCTTAACCAGAGGGGCGAATGGCGCAACTCTGCCTGGGGCCGCCGTGGCGGAGGT
GTCGGCGTTGGCAACTCATGA
Gene >OphauB2|1845
ATGACTTCGGACCAAGACTTGAGCGGCGACTGCTCTCGCGGCGACTACCCCGATGATCGGTCGGGTCCTGACTCG
GCCCACGCTTTTGGAGATAGGAACCGACAGAATGGAGGAAGCAAGACACCCGACAACTCGCATCATCTCAGACCC
AGTCCTGCAGGCTCTGGTCCCGCCTCAAACTCTGCGTCCAGCTCTGGTCTCTCTGGACCATCCCCGCCTGGCGCG
TGGCCTTCGGATGACGTGCAGCCGCGCAAAAGCGGAGAGATGAGTCGATCGCGACAGAGAAACGGCCATGTGCGC
ACCTGCAATAAGTGTGGCGAGCCGTTGACGGGCCAGTTTGTCCGTGCCCTCGATGGTACTTTTCACCTCGACTGC
TTCAAGTGCCGGGTACGTGCTTGTCGGGATGGGCCATTTTGCCCAGACAAGGCTGACTTGGGCTGCAAAAAACAG
GACTGTGGTCAAATCGTAGCTTCCAAATTCTTTCCTGCCGACAACGACGACGGAAACGGCCAATACCCGCTCTGT
GAAACCGACTACTTTGGACGACTAGGCTTGCTTTGCTACAAATGTGGCGGTGCGCTCAGGGGATCCTATATTACA
GCTCTGGACAGAAAATATCACATTGAACATTTCACCTGTTCTCTCTGTCCCACCGTGTTTGGCGCCCAGGATAGC
TACTACGAGCACGATGGCAATATCTACTGCCATTATCATTACTCAACGCGCTTTGCCCAGAAATGCAATGGCTGC
CAGACGGCCATTTTGAAGCAGTTTGTCGAAATCTACCGAAACGGCCAAGACCAGCACTGGCACCCTGAATGCTAC
ATGATACACAAGTTCTGGAATGTGCGTTTGGCACAGCCTGTAGAGACGGCACAGACAGAAGCGGCGCATGACTTC
AAATCGGATGCCGTCAATGAAAAACAGATTCGCCAGGGCGAGGAGCACATGGAGGACAAGGTCTACCGCATATGG
AGCGTCCTCTCCACCTTTGAAGAATCATCGGCGGCTTGCATCTCGGACATGCTCTTGCACGTTAGCAACGGCGCC
TACGTCGACGGCGTCCTGGTGGCTAAGCGCTTCATATGGCACGTTGAAGTCTTGTTTCAGTCTGCCGACCGGCTA
GACAAGACGGTGCAAGCGTGCAGCGATAAAGGTTAGTGACTGGTTACATGCCGCCGAGGCAGCGGGCATGACGCA
AAAGTTTTGGGCTGACGCGAGGCCCTTGGCCTTGCTCACAGGCATGTCGTACGGACGGGAAGCCAAGCTTTTATG
CAAAAAAATCGTGGCTTTTTTCTCCCTCTTGTCCAAGACACAGGATACCAGCGTCAGAAAGCTCGGCGTCACACA
AGAGCTCCTATCCTTGGTGACTGGCTTGGCGCATTATCTCAAACTCTTGATACGCATCTGCCTCCAAGCCGCCTT
GCGCTTGGAGCGACTGACGGGAAATAGCGATGGAATTCATCAATTGCTCACGGATCTGGCTGATTTTGAAACTTA
TAAGACGGACGAGAGCCTTCTGCAAATCACCATGGGCGGCGCCAAGCTATCAACCAAAGACTCGGATCACTGCGT
TGTCTGCACCAGATCTGTGGAAGATGAGTGCGCCAAGAGCGGAGACTACAGGTGGCACATTGGCTGTGTCAATTG
TTCGCGCTGTTCACGAGAGCTGGGACGGAGTCTGGAAGAAGCGCGTCTAAATCCTTATGACGGCAAGATATACTG
CACTAGGTGTTTGGCCCCCAAACGAGACGACATGGCCACGTTTGAGCACGTTAGCAAGCTTCAGCAGTATGCCTT
TCTCCTCAAGGTGGCACTGGCACGGCTATTGGATATTCTCCGCAACAATGGCGCCCTGCCCAACACATCGGCAGA
ATCAAGCATCGTCCAAGGCGGAGAGGAAAGTAGCAGGCTCGAAGCAGGTCCGTCCTTCTTGAATTCCGAGTCACG
ATCCAAGTCTTATGCTCCAGGAACTCCTCAAGACCGACATCGCGAATCAACATATGAGAACACGTTGAACGAAGT
TCGTAGGTTGCGAAGCACACGGCTGGATCGTCATCTTGCCTCGAGTGTCCGACAGGCACGGACATCTCGTGTAAT
GGATGCAGACGGCCAAGGTCCGCTCCCCGACTTGTCTGGGACTGGCCAAGGCGAAGCAGAAGGACAAGCACCATC
GGATCTCATGTTTGGGCAGAACGACGCCATTACGCTTGATGATATTCCACGCATAGTTGCTGCTGAGCAGTCGCG
CGAGCAGCAGCAGCAACAACGCAATAGTAACTTGCGACAGGACCTCATCAGGTCACCCGCCTCTGAGCCAGGAAG
AGTTGCAGGACATCAACGGACACAGTCGGCATCTAGAGACCCCGATGTTCGCGCAGCCAATGGCGCCCCTTGTCG
GCTAACGCGCAAGTTCTTCCCAGAGCTTTCGGGACTCGAGTACTTCAACGTGCGGCATCTGGCCGTCTTGACAAT
GCAGCCCATGGTGGAGCAAGAGTTTGCGCTTGAGGAGCTTCTTGGCTTGATTGAGTCTCGGAAGCCCCCTACGTT
TTGGAAAAATCTCGGCAAGGCATTCAAGAATGACAAGAATAGGAATGTCAAGAAGAAGGGAGTCTTTGGCGTGCC
GCTCGACGTGATTATTGAGCGTGACGGAGCAGATTCGACTGACGGCGTTGGCCCGGGAACTCTACGTATTCCAGT
CGTTGTGGAAGACATCATTTCATCGATGCGCAAGATGGACCTTTCAGTTGAGGGCGTCTTCCGCAAGAATGGCAA
CATCAAGAAGCAACAGGAAATGGTGGACAAGATCAATGCCGAAGGATGCGACGTGGTCAACTTCATGGAGCAGCC
CGTGGTGCAGTTGGCGGCGCTCCTCAAGCGATATCTGCGCGACTTGCCGGATCCGTTGATGACGCACAAGCTGTA
CCGACTGTGGGTGAGTGCGGCAAAAATGACGGATCCTGAAAGGCGGAAACAGTGTCTGCACTTGACGTGCTGCTT
GCTGCCCAAGAGCCACCGTGATTGCCTCGAGATTCTCTTTAGTTTTTTGAAATGGGCCGGCTCCTTCCACCAGGT
TGACGAAGAGATTGGCTCCAAGATGGACATTCGCAATTTGGCCACTGTGATAGCTCCAAATGTCTTGACAAATCC
CAACAAGGCCCCGGCCCTAGACAGCGAAGCTATATTCATCATCGATGCCGTCGAGACGCTCATTGCCAATATCGA
GGACATGTGTCAGGTGAGCTACTGGACCGGGCTCGATGAAATGTATTGGCAGTGGGACTAACAGAAAGACTACCT
AGGTTCCCACTGAAATATTGACGCTACTAAACGACCCCTATTTGTTTAGTAACAATGGCGAAACGACGACCAAGG
AGATTCTCAGGCGGTTCCAGGACCGACGGGAACAGATTCCTGCAGCCGACGTGACCGAGGTGTTTAATAGGCAGG
ACACTTCGACGCGGTCGCCGCCGCGGCGTGTTGAGACGGATCCATCAGTCTGGCAGGGCGAGAGATCGGTGCGAC
CAGTTCAGGAGTCAGTCATGGCTCAGCCAGTCTCGTCGGGCCAGGGCAGCTCGGGGCAGAGGCAATGGACAGGAG
CCGGCGAGCGCCCATTACCGTACAACCAGCGATTCAACCATTCAGACAGCCATCTCGAAAACTCTGAGCTTAACC
AGAGGGGCGAATGGCGCAACTCTGCCTGGGGCCGCCGTGGCGGAGGTGTCGGCGTTGGCAACTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail