Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1844
Gene name
LocationContig_152:7451..8713
Strand+
Gene length (bp)1262
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.4E-63 13 298
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.9E-30 12 255
PF04321 RmlD_sub_bind RmlD substrate binding domain 1.3E-12 11 175
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.8E-10 14 251
PF07993 NAD_binding_4 Male sterility protein 9.1E-09 78 176
PF13460 NAD_binding_10 NAD(P)H-binding 1.3E-09 16 171
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 7.2E-06 12 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43050|ERG26_SCHPO Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg26 PE=3 SV=1 13 388 1.0E-71
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG26 PE=1 SV=1 12 389 4.0E-71
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 14 389 3.0E-49
sp|Q3ZBE9|NSDHL_BOVIN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Bos taurus GN=NSDHL PE=2 SV=1 5 389 2.0E-46
sp|Q9FX01|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 OS=Arabidopsis thaliana GN=3BETAHSD/D1 PE=2 SV=1 13 396 4.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43050|ERG26_SCHPO Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg26 PE=3 SV=1 13 388 1.0E-71
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG26 PE=1 SV=1 12 389 4.0E-71
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 14 389 3.0E-49
sp|Q3ZBE9|NSDHL_BOVIN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Bos taurus GN=NSDHL PE=2 SV=1 5 389 2.0E-46
sp|Q9FX01|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 OS=Arabidopsis thaliana GN=3BETAHSD/D1 PE=2 SV=1 13 396 4.0E-46
sp|Q5PPL3|NSDHL_RAT Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Rattus norvegicus GN=Nsdhl PE=2 SV=1 14 389 6.0E-45
sp|Q15738|NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens GN=NSDHL PE=1 SV=2 14 389 3.0E-44
sp|Q67ZE1|HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 OS=Arabidopsis thaliana GN=3BETAHSD/D2 PE=2 SV=2 13 389 6.0E-42
sp|A9X4U2|HSDD3_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 3 OS=Arabidopsis thaliana GN=3BETAHSD/D3 PE=2 SV=2 9 400 6.0E-38
sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 12 389 9.0E-31
sp|Q8WUS8|D42E1_HUMAN Short-chain dehydrogenase/reductase family 42E member 1 OS=Homo sapiens GN=SDR42E1 PE=2 SV=2 12 389 1.0E-30
sp|A8DZE7|D42E1_DANRE Short-chain dehydrogenase/reductase family 42E member 1 OS=Danio rerio GN=sdr42e1 PE=2 SV=1 13 389 3.0E-30
sp|P9WQP7|3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1106c PE=1 SV=1 6 395 1.0E-28
sp|P9WQP6|3BHS_MYCTO 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1137 PE=3 SV=1 6 395 1.0E-28
sp|A6NKP2|D42E2_HUMAN Putative short-chain dehydrogenase/reductase family 42E member 2 OS=Homo sapiens GN=SDR42E2 PE=3 SV=3 2 374 2.0E-27
sp|Q0IH73|D42E1_XENLA Short-chain dehydrogenase/reductase family 42E member 1 OS=Xenopus laevis GN=sdr42e1 PE=2 SV=1 12 392 6.0E-27
sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 64 389 1.0E-26
sp|Q9D665|D42E1_MOUSE Short-chain dehydrogenase/reductase family 42E member 1 OS=Mus musculus GN=Sdr42e1 PE=1 SV=1 82 389 3.0E-26
sp|Q60555|3BHS1_MESAU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Mesocricetus auratus GN=HSD3B1 PE=2 SV=3 13 375 5.0E-23
sp|P14060|3BHS1_HUMAN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Homo sapiens GN=HSD3B1 PE=1 SV=2 13 388 9.0E-23
sp|P27365|3BHS1_MACMU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Macaca mulatta GN=HSD3B1 PE=2 SV=2 13 388 1.0E-22
sp|Q64421|3BHS2_MESAU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Mesocricetus auratus GN=HSD3B2 PE=2 SV=3 13 375 1.0E-22
sp|Q9N119|3BHS_PIG 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Sus scrofa GN=HSD3B PE=2 SV=4 13 400 2.0E-22
sp|P14893|3BHS_BOVIN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Bos taurus GN=HSD3B PE=1 SV=2 13 400 7.0E-22
sp|P26439|3BHS2_HUMAN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Homo sapiens GN=HSD3B2 PE=1 SV=2 13 388 2.0E-21
sp|P24815|3BHS1_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Mus musculus GN=Hsd3b1 PE=1 SV=3 13 389 2.0E-21
sp|Q9EQC1|3BHS7_MOUSE 3 beta-hydroxysteroid dehydrogenase type 7 OS=Mus musculus GN=Hsd3b7 PE=1 SV=1 13 388 5.0E-21
sp|Q6GZS4|052L_FRG3G Uncharacterized protein 052L OS=Frog virus 3 (isolate Goorha) GN=FV3-052L PE=3 SV=1 13 389 5.0E-21
sp|Q5IFP1|3BHS_CANLF 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Canis lupus familiaris GN=HSD3B PE=2 SV=3 13 400 8.0E-21
sp|Q67477|3BHS_FOWPN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Fowlpox virus (strain NVSL) GN=FPV046 PE=3 SV=2 13 389 3.0E-20
sp|Q62878|3BHS4_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4 OS=Rattus norvegicus GN=Hsd3b6 PE=2 SV=4 13 389 3.0E-20
sp|O35469|3BHS6_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6 OS=Mus musculus GN=Hsd3b6 PE=1 SV=4 13 388 4.0E-20
sp|P26149|3BHS2_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Mus musculus GN=Hsd3b2 PE=1 SV=4 13 389 5.0E-19
sp|P26150|3BHS3_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3 OS=Mus musculus GN=Hsd3b3 PE=1 SV=3 13 389 8.0E-19
sp|P26670|3BHS_VACCW 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Western Reserve) GN=VACWR170 PE=3 SV=1 14 290 3.0E-18
sp|P21097|3BHS_VACCC 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Copenhagen) GN=A44L PE=3 SV=1 14 290 3.0E-18
sp|P22071|3BHS1_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Rattus norvegicus GN=Hsd3b1 PE=2 SV=3 13 389 1.0E-17
sp|Q61767|3BHS4_MOUSE 3 beta-hydroxysteroid dehydrogenase type 4 OS=Mus musculus GN=Hsd3b4 PE=1 SV=3 13 389 2.0E-17
sp|O46516|3BHS_HORSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Equus caballus GN=HSD3B PE=2 SV=3 13 388 5.0E-17
sp|O57245|3BHS_VACCA 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Ankara) GN=MVA157L PE=3 SV=1 14 290 5.0E-17
sp|Q9H2F3|3BHS7_HUMAN 3 beta-hydroxysteroid dehydrogenase type 7 OS=Homo sapiens GN=HSD3B7 PE=1 SV=2 13 388 1.0E-16
sp|O35296|3BHS3_MESAU 3 beta-hydroxysteroid dehydrogenase type 3 OS=Mesocricetus auratus GN=HSD3B3 PE=2 SV=3 13 389 2.0E-16
sp|P27364|3BHS5_RAT 3 beta-hydroxysteroid dehydrogenase type 5 OS=Rattus norvegicus GN=Hsd3b5 PE=2 SV=3 13 389 3.0E-16
sp|P22072|3BHS2_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Rattus norvegicus GN=Hsd3b PE=2 SV=3 13 389 3.0E-16
sp|Q61694|3BHS5_MOUSE 3 beta-hydroxysteroid dehydrogenase type 5 OS=Mus musculus GN=Hsd3b5 PE=1 SV=4 13 389 1.0E-13
sp|O35048|3BHS7_RAT 3 beta-hydroxysteroid dehydrogenase type 7 OS=Rattus norvegicus GN=Hsd3b7 PE=2 SV=1 13 388 3.0E-12
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 12 267 3.0E-10
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 12 267 8.0E-10
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 10 256 2.0E-08
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 11 256 2.0E-08
sp|O84903|GALE_LACCA UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1 12 256 3.0E-08
sp|Q553X7|GALE_DICDI UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1 12 256 5.0E-08
sp|Q57301|GALE_YEREN UDP-glucose 4-epimerase OS=Yersinia enterocolitica GN=galE PE=3 SV=1 12 250 5.0E-08
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 12 254 5.0E-08
sp|Q9SUN3|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=3 11 252 6.0E-08
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 12 260 7.0E-08
sp|Q8R059|GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=1 SV=1 12 267 1.0E-07
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 12 261 1.0E-07
sp|Q54L85|NSDHL_DICDI Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Dictyostelium discoideum GN=nsdhl PE=3 SV=1 9 382 2.0E-07
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 7 252 4.0E-07
sp|P56985|GALE_NEIMB UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=galE PE=3 SV=1 9 263 1.0E-06
sp|P56986|GALE_NEIMC UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup C GN=galE PE=3 SV=1 9 263 1.0E-06
sp|Q14376|GALE_HUMAN UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE=1 SV=2 12 256 1.0E-06
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 11 256 1.0E-06
sp|P56997|GALE_NEIMA UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=galE PE=3 SV=1 9 263 3.0E-06
sp|Q5R8D0|GALE_PONAB UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1 12 256 3.0E-06
sp|Q3T105|GALE_BOVIN UDP-glucose 4-epimerase OS=Bos taurus GN=GALE PE=2 SV=2 12 136 3.0E-06
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 9 259 3.0E-06
sp|P37777|RMLB_SHIFL dTDP-glucose 4,6-dehydratase OS=Shigella flexneri GN=rfbB PE=3 SV=2 12 117 8.0E-06
sp|O64749|ARAE2_ARATH Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3 7 252 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0008610 lipid biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008150 biological_process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016229 steroid dehydrogenase activity No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008202 steroid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1844
MAAPDTPSLGHVVVIGGNGFLGHHIVAQALDSSRWSVSGVSSLDMRVDRNRSPDSRAAYHACDITDAAALSELLE
RLQPDVVIHTASPVASGQDGPVARDLYRRVNIDGTRAVVDACCQARVKALVYTSSASVISDNRSDLRNADERWPL
VRGAQQHEYYSETKAAAEQLVLDANRSPHAAAPEMSSPGSSRNLLLTTALRPAGIFGEGDVQTLAGFLNALRTRR
TNVQLGDNTNMFDFTYVGNVAHAHLLAANALITTAAAHTQPLDHEKVDGQVFFITNDSPCYFWDFARAVWQAAAS
ANSTESPSPYPPPVPPCRVWVLSPSLSRSLGFLSELVCNLLGKSPTFTRQRAAMSTMTRYYNITKAKTLLGYQPL
WTLPQGVARGVAWFLNQQNQPLVKS*
Coding >OphauB2|1844
ATGGCAGCCCCCGACACGCCCTCTCTGGGCCACGTCGTCGTGATTGGCGGCAACGGCTTCCTCGGCCACCACATT
GTCGCCCAGGCTCTCGACTCGTCTCGATGGTCCGTCTCGGGCGTCAGCTCGCTCGACATGCGCGTGGACCGCAAC
CGCAGCCCCGACTCGCGTGCCGCCTACCACGCCTGCGACATTACGGATGCTGCGGCCCTGTCGGAGCTGCTGGAG
CGCCTCCAGCCCGACGTGGTGATTCACACAGCCAGCCCAGTGGCCAGCGGCCAAGACGGCCCTGTTGCCCGAGAC
TTGTATCGCCGCGTCAACATTGACGGCACCCGCGCCGTCGTCGACGCTTGTTGCCAGGCCCGTGTCAAGGCCTTG
GTCTACACCAGCTCAGCCAGTGTCATTAGCGACAATCGCTCCGACTTGCGCAATGCCGACGAGCGCTGGCCCCTT
GTGCGCGGCGCCCAGCAGCACGAGTACTACTCGGAGACCAAGGCCGCCGCCGAACAACTTGTCCTCGACGCAAAC
CGCTCTCCCCACGCTGCCGCCCCCGAAATGTCCTCGCCTGGGTCCTCGAGAAACCTGCTCCTCACCACCGCCCTC
CGCCCCGCCGGCATCTTTGGCGAGGGCGACGTCCAGACGCTCGCCGGCTTTCTCAATGCCCTGCGCACCCGTCGC
ACAAACGTCCAGCTCGGCGACAACACAAACATGTTCGACTTTACCTATGTCGGCAATGTGGCCCACGCCCATCTG
CTCGCCGCCAATGCTCTCATCACCACCGCCGCCGCCCATACTCAGCCTCTGGACCATGAAAAGGTCGACGGCCAA
GTCTTCTTCATCACAAACGATTCCCCCTGCTACTTTTGGGACTTTGCTCGCGCCGTCTGGCAGGCCGCCGCCTCT
GCCAATTCCACAGAGTCGCCCTCTCCTTACCCACCTCCCGTGCCACCTTGCCGCGTCTGGGTTTTGTCTCCTTCT
CTCAGCCGCTCCCTTGGCTTTTTGAGCGAGCTTGTCTGCAACTTGTTGGGAAAGTCTCCCACCTTTACCCGCCAG
CGCGCTGCCATGTCCACCATGACGCGCTACTACAACATCACAAAAGCCAAGACGCTCCTTGGCTACCAGCCCTTG
TGGACTCTGCCCCAAGGTGTCGCCCGCGGAGTCGCTTGGTTCCTCAATCAACAGAACCAGCCCCTTGTCAAATCG
TAG
Transcript >OphauB2|1844
ATGGCAGCCCCCGACACGCCCTCTCTGGGCCACGTCGTCGTGATTGGCGGCAACGGCTTCCTCGGCCACCACATT
GTCGCCCAGGCTCTCGACTCGTCTCGATGGTCCGTCTCGGGCGTCAGCTCGCTCGACATGCGCGTGGACCGCAAC
CGCAGCCCCGACTCGCGTGCCGCCTACCACGCCTGCGACATTACGGATGCTGCGGCCCTGTCGGAGCTGCTGGAG
CGCCTCCAGCCCGACGTGGTGATTCACACAGCCAGCCCAGTGGCCAGCGGCCAAGACGGCCCTGTTGCCCGAGAC
TTGTATCGCCGCGTCAACATTGACGGCACCCGCGCCGTCGTCGACGCTTGTTGCCAGGCCCGTGTCAAGGCCTTG
GTCTACACCAGCTCAGCCAGTGTCATTAGCGACAATCGCTCCGACTTGCGCAATGCCGACGAGCGCTGGCCCCTT
GTGCGCGGCGCCCAGCAGCACGAGTACTACTCGGAGACCAAGGCCGCCGCCGAACAACTTGTCCTCGACGCAAAC
CGCTCTCCCCACGCTGCCGCCCCCGAAATGTCCTCGCCTGGGTCCTCGAGAAACCTGCTCCTCACCACCGCCCTC
CGCCCCGCCGGCATCTTTGGCGAGGGCGACGTCCAGACGCTCGCCGGCTTTCTCAATGCCCTGCGCACCCGTCGC
ACAAACGTCCAGCTCGGCGACAACACAAACATGTTCGACTTTACCTATGTCGGCAATGTGGCCCACGCCCATCTG
CTCGCCGCCAATGCTCTCATCACCACCGCCGCCGCCCATACTCAGCCTCTGGACCATGAAAAGGTCGACGGCCAA
GTCTTCTTCATCACAAACGATTCCCCCTGCTACTTTTGGGACTTTGCTCGCGCCGTCTGGCAGGCCGCCGCCTCT
GCCAATTCCACAGAGTCGCCCTCTCCTTACCCACCTCCCGTGCCACCTTGCCGCGTCTGGGTTTTGTCTCCTTCT
CTCAGCCGCTCCCTTGGCTTTTTGAGCGAGCTTGTCTGCAACTTGTTGGGAAAGTCTCCCACCTTTACCCGCCAG
CGCGCTGCCATGTCCACCATGACGCGCTACTACAACATCACAAAAGCCAAGACGCTCCTTGGCTACCAGCCCTTG
TGGACTCTGCCCCAAGGTGTCGCCCGCGGAGTCGCTTGGTTCCTCAATCAACAGAACCAGCCCCTTGTCAAATCG
TAG
Gene >OphauB2|1844
ATGGCAGCCCCCGACACGCCCTCTCTGGGCCACGTCGTCGTGATTGGCGGCAACGGCTTCCTCGGCCACCACATT
GTCGCCCAGGCTCTCGACTCGTCTCGATGGTCCGTCTCGGGCGTCAGCTCGCTCGACATGCGCGTGGACCGCAAC
CGCAGCCCCGACTCGCGTGCCGCCTACCACGCCTGCGACATTACGGATGCTGCGGCCCTGTCGGAGCTGCTGGAG
CGCCTCCAGCCCGACGTGGTGATTCACACAGCCAGCCCAGTGGCCAGCGGCCAAGACGGCCCTGTTGCCCGAGAC
TTGTATCGCCGCGTCAACATTGACGGCACCCGCGCCGTCGTCGACGCTTGTTGCCAGGCCCGTGTCAAGGCCTTG
GTCTACACCAGCTCAGCCAGTGTCATTAGCGACAATCGCTCCGACTTGCGCAATGCCGACGAGCGCTGGCCCCTT
GTGCGCGGCGCCCAGCAGCACGAGTACTACTCGGAGACCAAGGTTGTCCTCTGCCCCTTGCCAAAAACAGGCCCT
CCCACTGACTCTGCTTGCCCGGACAGGCCGCCGCCGAACAACTTGTCCTCGACGCAAACCGCTCTCCCCACGCTG
CCGCCCCCGAAATGTCCTCGCCTGGGTCCTCGAGAAACCTGCTCCTCACCACCGCCCTCCGCCCCGCCGGCATCT
TTGGCGAGGGCGACGTCCAGACGCTCGCCGGCTTTCTCAATGCCCTGCGCACCCGTCGCACAAACGTCCAGCTCG
GCGACAACACAAACATGTTCGACTTTACCTATGTCGGCAATGTGGCCCACGCCCATCTGCTCGCCGCCAATGCTC
TCATCACCACCGCCGCCGCCCATACTCAGCCTCTGGACCATGAAAAGGTCGACGGCCAAGTCTTCTTCATCACAA
ACGATTCCCCCTGCTACTTTTGGGACTTTGCTCGCGCCGTCTGGCAGGCCGCCGCCTCTGCCAATTCCACAGAGT
CGCCCTCTCCTTACCCACCTCCCGTGCCACCTTGCCGCGTCTGGGTTTTGTCTCCTTCTCTCAGCCGCTCCCTTG
GCTTTTTGAGCGAGCTTGTCTGCAACTTGTTGGGAAAGTCTCCCACCTTTACCCGCCAGCGCGCTGCCATGTCCA
CCATGACGCGCTACTACAACATCACAAAAGCCAAGACGCTCCTTGGCTACCAGCCCTTGTGGACTCTGCCCCAAG
GTGTCGCCCGCGGAGTCGCTTGGTTCCTCAATCAACAGAACCAGCCCCTTGTCAAATCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail