Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1842
Gene name
LocationContig_152:570..2064
Strand-
Gene length (bp)1494
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.0E-11 62 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22680|CP7A1_HUMAN Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 29 445 2.0E-13
sp|P18125|CP7A1_RAT Cholesterol 7-alpha-monooxygenase OS=Rattus norvegicus GN=Cyp7a1 PE=1 SV=1 29 429 5.0E-12
sp|O46491|CP7A1_PIG Cholesterol 7-alpha-monooxygenase OS=Sus scrofa GN=CYP7A1 PE=3 SV=1 29 445 7.0E-12
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 20 443 1.0E-11
sp|Q64505|CP7A1_MOUSE Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 29 443 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22680|CP7A1_HUMAN Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 29 445 2.0E-13
sp|P18125|CP7A1_RAT Cholesterol 7-alpha-monooxygenase OS=Rattus norvegicus GN=Cyp7a1 PE=1 SV=1 29 429 5.0E-12
sp|O46491|CP7A1_PIG Cholesterol 7-alpha-monooxygenase OS=Sus scrofa GN=CYP7A1 PE=3 SV=1 29 445 7.0E-12
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 20 443 1.0E-11
sp|Q64505|CP7A1_MOUSE Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 29 443 2.0E-11
sp|P46634|CP7A1_CRIGR Cholesterol 7-alpha-monooxygenase OS=Cricetulus griseus GN=CYP7A1 PE=3 SV=1 29 445 5.0E-11
sp|P51542|CP7A1_RABIT Cholesterol 7-alpha-monooxygenase OS=Oryctolagus cuniculus GN=CYP7A1 PE=1 SV=1 29 445 7.0E-11
sp|Q63688|CP7B1_RAT 25-hydroxycholesterol 7-alpha-hydroxylase (Fragment) OS=Rattus norvegicus GN=Cyp7b1 PE=1 SV=1 121 443 7.0E-11
sp|Q60991|CP7B1_MOUSE 25-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp7b1 PE=2 SV=2 183 443 2.0E-10
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 198 410 2.0E-09
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 194 443 2.0E-08
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 203 416 3.0E-08
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 197 413 7.0E-08
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 203 416 8.0E-08
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 230 410 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1842
MYIYVLKYFLGIPEPALSVYRADDSGPLSKAYPHSNVEPQNRVDHIIHHQYFRAYSGPGLDPTVKRFKHSLDRRI
EGMHWDDNWTQEGNIESLFQHVAAASVIECIFGPALLRLNPNFVQDVWKFDDFVPWFPRAIPAFFMPESYRLRER
LRGQLQRWYQYARLHFQESDINEDGDGDAFWGSELMRERQRTLRQVPHHDDYVLASMDMGFAWGTVGNTIPVSML
ATIHVYKDPSLLERVRRSIAETLGQRSLMDLDPRELADIPLLSSIYTEVLRVYVNNYFVVSSPHQDVELGQWRLP
KGQIGLLNSNISQMDKTFWNTKDGLYPVETFWADRFIIDPADASSGPILPALRKTSLRAEQSGDGKPYFSTEGIE
GSWFPYGGGYSICPGRFLAKRAGVFTCAYLVHGYDVEVGQEEIHLDTCRFGLGIGALKKPIPFRIRKRRLESEAA
CVKTE*
Coding >OphauB2|1842
ATGTACATTTACGTATTGAAATATTTCTTGGGCATCCCGGAACCAGCCTTGTCAGTCTATCGAGCCGATGATTCA
GGTCCGCTCTCCAAAGCGTACCCGCATAGCAATGTTGAGCCGCAGAACCGCGTCGATCATATTATCCATCATCAA
TATTTCCGGGCGTATAGCGGCCCTGGACTGGATCCAACAGTGAAGCGTTTCAAACACTCGCTCGACAGGAGGATA
GAGGGCATGCACTGGGACGACAATTGGACACAAGAGGGCAATATCGAGTCCCTTTTCCAACACGTTGCAGCTGCG
TCAGTGATTGAGTGCATCTTTGGGCCCGCCTTGCTTCGTCTGAATCCCAATTTTGTGCAAGATGTATGGAAGTTT
GACGACTTTGTTCCGTGGTTCCCTCGAGCTATTCCAGCCTTTTTCATGCCCGAGTCGTATAGGCTGCGGGAGCGA
CTCAGAGGTCAGTTACAGCGGTGGTATCAATACGCGAGACTGCACTTTCAGGAATCCGACATTAATGAGGATGGT
GACGGCGATGCCTTTTGGGGATCAGAGTTGATGAGAGAGCGACAAAGGACGTTGCGGCAGGTGCCACACCATGAC
GACTATGTCCTTGCTTCCATGGACATGGGTTTCGCCTGGGGTACGGTGGGGAATACTATTCCTGTCTCGATGCTT
GCGACGATACACGTATACAAGGATCCGAGTCTCCTTGAGCGTGTGCGGAGAAGCATTGCCGAGACTCTGGGCCAA
CGCTCTCTCATGGACTTGGATCCTCGAGAACTGGCCGATATTCCGCTTCTATCATCCATATATACAGAGGTACTT
CGTGTATACGTCAACAATTACTTTGTCGTTAGTTCGCCGCATCAAGATGTTGAGCTAGGGCAATGGCGGCTGCCC
AAGGGCCAGATTGGCCTCCTCAATTCGAATATTTCCCAAATGGACAAGACCTTTTGGAACACCAAAGATGGCTTG
TACCCAGTCGAAACCTTTTGGGCTGACCGCTTCATAATCGACCCGGCGGATGCATCGAGCGGACCCATCCTACCG
GCGCTGAGGAAGACGTCACTGCGTGCCGAGCAGAGCGGCGACGGGAAGCCGTACTTTTCAACCGAGGGCATTGAG
GGGTCCTGGTTTCCATATGGCGGTGGCTACTCCATTTGTCCTGGTAGGTTCCTGGCAAAGCGGGCTGGTGTCTTT
ACCTGTGCCTATTTAGTGCACGGATACGATGTTGAAGTTGGGCAAGAGGAGATTCATCTCGACACTTGCAGGTTT
GGACTGGGGATTGGAGCTTTGAAAAAGCCGATTCCCTTTCGGATTAGAAAGAGAAGGCTCGAGTCTGAAGCTGCA
TGTGTCAAGACGGAATGA
Transcript >OphauB2|1842
ATGTACATTTACGTATTGAAATATTTCTTGGGCATCCCGGAACCAGCCTTGTCAGTCTATCGAGCCGATGATTCA
GGTCCGCTCTCCAAAGCGTACCCGCATAGCAATGTTGAGCCGCAGAACCGCGTCGATCATATTATCCATCATCAA
TATTTCCGGGCGTATAGCGGCCCTGGACTGGATCCAACAGTGAAGCGTTTCAAACACTCGCTCGACAGGAGGATA
GAGGGCATGCACTGGGACGACAATTGGACACAAGAGGGCAATATCGAGTCCCTTTTCCAACACGTTGCAGCTGCG
TCAGTGATTGAGTGCATCTTTGGGCCCGCCTTGCTTCGTCTGAATCCCAATTTTGTGCAAGATGTATGGAAGTTT
GACGACTTTGTTCCGTGGTTCCCTCGAGCTATTCCAGCCTTTTTCATGCCCGAGTCGTATAGGCTGCGGGAGCGA
CTCAGAGGTCAGTTACAGCGGTGGTATCAATACGCGAGACTGCACTTTCAGGAATCCGACATTAATGAGGATGGT
GACGGCGATGCCTTTTGGGGATCAGAGTTGATGAGAGAGCGACAAAGGACGTTGCGGCAGGTGCCACACCATGAC
GACTATGTCCTTGCTTCCATGGACATGGGTTTCGCCTGGGGTACGGTGGGGAATACTATTCCTGTCTCGATGCTT
GCGACGATACACGTATACAAGGATCCGAGTCTCCTTGAGCGTGTGCGGAGAAGCATTGCCGAGACTCTGGGCCAA
CGCTCTCTCATGGACTTGGATCCTCGAGAACTGGCCGATATTCCGCTTCTATCATCCATATATACAGAGGTACTT
CGTGTATACGTCAACAATTACTTTGTCGTTAGTTCGCCGCATCAAGATGTTGAGCTAGGGCAATGGCGGCTGCCC
AAGGGCCAGATTGGCCTCCTCAATTCGAATATTTCCCAAATGGACAAGACCTTTTGGAACACCAAAGATGGCTTG
TACCCAGTCGAAACCTTTTGGGCTGACCGCTTCATAATCGACCCGGCGGATGCATCGAGCGGACCCATCCTACCG
GCGCTGAGGAAGACGTCACTGCGTGCCGAGCAGAGCGGCGACGGGAAGCCGTACTTTTCAACCGAGGGCATTGAG
GGGTCCTGGTTTCCATATGGCGGTGGCTACTCCATTTGTCCTGGTAGGTTCCTGGCAAAGCGGGCTGGTGTCTTT
ACCTGTGCCTATTTAGTGCACGGATACGATGTTGAAGTTGGGCAAGAGGAGATTCATCTCGACACTTGCAGGTTT
GGACTGGGGATTGGAGCTTTGAAAAAGCCGATTCCCTTTCGGATTAGAAAGAGAAGGCTCGAGTCTGAAGCTGCA
TGTGTCAAGACGGAATGA
Gene >OphauB2|1842
ATGTACATTTACGTATTGAAATATTTCTTGGGCATCCCGGAACCAGCCTTGTCAGTCTATCGAGCCGATGATTCA
GGTCCGCTCTCCAAAGCGTACCCGCATAGCAATGTTGAGCCGCAGAACCGCGTCGATCATATTATCCATCATCAA
TATTTCCGGGCGTATAGCGGCCCTGGACTGGATCCAACAGTGAAGCGTTTCAAACACTCGCTCGACAGGAGGATA
GAGGGCATGCACTGGGACGACAATTGGACACAAGAGGGCAATATCGAGTCCCTTTTCCAACACGTTGCAGCTGCG
TCAGTGATTGAGTGCATCTTTGGGCCCGCCTTGCTTCGTCTGAATCCCAATTTTGTGCAAGATGTATGGAAGTTT
GACGACTTTGTTCCGTGGTTCCCTCGAGCTATTCCAGCCTTTTTCATGCCCGAGTCGTATAGGCTGCGGGAGCGA
CTCAGAGGTCAGTTACAGCGGTGGTATCAATACGCGAGACTGCACTTTCAGGAATCCGACATTAATGAGGATGGT
GACGGCGATGCCTTTTGGGGATCAGAGTTGATGAGAGAGCGACAAAGGACGTTGCGGCAGGTGCCACACCATGAC
GACTATGTCCTTGCTTCCATGGACATGGGTTTCGCCTGGGGGTAGGAATGGCGCCAAGCCATGTTTACTATACGA
ACCAAGGCTAATGTTTCCATAGTACGGTGGGGAATACTATTCCTGTCTCGATGCTTGCGACGATACACGTATACA
AGGATCCGAGTCTCCTTGAGCGTGTGCGGAGAAGCATTGCCGAGACTCTGGGCCAACGCTCTCTCATGGACTTGG
ATCCTCGAGAACTGGCCGATATTCCGCTTCTATCATCCATATATACAGAGGTACTTCGTGTATACGTCAACAATT
ACTTTGTCGTTAGTTCGCCGCATCAAGATGTTGAGCTAGGGCAATGGCGGCTGCCCAAGGGCCAGATTGGCCTCC
TCAATTCGAATATTTCCCAAATGGACAAGACCTTTTGGAACACCAAAGATGGCTTGTACCCAGTCGAAACCTTTT
GGGCTGACCGCTTCATAATCGACCCGGCGGATGCATCGAGCGGACCCATCCTACCGGCGCTGAGGAAGACGTCAC
TGCGTGCCGAGCAGAGCGGCGACGGGAAGCCGTACTTTTCAACCGAGGGCATTGAGGGGTCCTGGTTTCCATATG
GCGGTAGGTTTTACCCTTGGCGTGAAGAGTTGATTCGCCCAACGCAGTAATGTGTTGACTGATGAATGTAAAGGT
GGCTACTCCATTTGTCCTGGTAGGTTCCTGGCAAAGCGGGCTGGTGTCTTTACCTGTGCCTATTTAGTGCACGGA
TACGATGTTGAAGTTGGGCAAGAGGAGATTCATCTCGACACTTGCAGGTTTGGACTGGGGATTGGAGCTTTGAAA
AAGCCGATTCCCTTTCGGATTAGAAAGAGAAGGCTCGAGTCTGAAGCTGCATGTGTCAAGACGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail