Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|184
Gene name
LocationContig_10:60891..67050
Strand+
Gene length (bp)6159
Transcript length (bp)6090
Coding sequence length (bp)6090
Protein length (aa) 2030

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 1.2E-41 980 1275
PF00271 Helicase_C Helicase conserved C-terminal domain 1.4E-21 1330 1437
PF04851 ResIII Type III restriction enzyme, res subunit 1.6E-05 980 1148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 893 1475 8.0E-85
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 934 1490 2.0E-74
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 948 1491 5.0E-72
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 934 1497 2.0E-71
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 905 1490 7.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 893 1475 8.0E-85
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 934 1490 2.0E-74
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 948 1491 5.0E-72
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 934 1497 2.0E-71
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 905 1490 7.0E-71
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 925 1489 8.0E-71
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 934 1497 2.0E-70
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 925 1489 5.0E-70
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 905 1487 3.0E-69
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 925 1487 2.0E-68
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 958 1489 3.0E-67
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 925 1489 1.0E-66
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 958 1489 1.0E-66
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 958 1489 2.0E-66
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 858 1490 3.0E-66
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 958 1489 3.0E-66
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 958 1474 4.0E-66
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 958 1474 2.0E-65
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 958 1491 2.0E-64
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 956 1498 4.0E-63
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 922 1489 4.0E-61
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 948 1491 2.0E-58
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 961 1522 5.0E-58
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 956 1491 5.0E-58
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 922 1491 6.0E-58
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 957 1491 2.0E-57
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 958 1491 2.0E-57
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 958 1523 8.0E-57
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 948 1491 2.0E-56
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 958 1491 2.0E-55
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 958 1491 3.0E-55
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 948 1491 1.0E-53
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 933 1265 1.0E-53
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 983 1491 1.0E-53
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 933 1265 2.0E-53
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 933 1265 3.0E-53
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 933 1265 3.0E-53
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 940 1491 3.0E-53
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 957 1475 5.0E-53
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 955 1473 1.0E-52
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 961 1492 7.0E-52
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 882 1277 4.0E-51
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 955 1490 5.0E-51
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 957 1489 5.0E-51
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 955 1473 6.0E-50
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 957 1515 1.0E-49
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 948 1491 3.0E-49
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 937 1491 4.0E-49
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 948 1491 4.0E-49
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 948 1491 5.0E-49
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 948 1491 6.0E-49
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 958 1476 1.0E-48
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 948 1491 1.0E-48
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 957 1490 2.0E-48
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 954 1472 2.0E-48
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 954 1472 9.0E-48
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 953 1472 1.0E-47
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 936 1491 1.0E-47
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 936 1491 2.0E-47
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 936 1491 3.0E-47
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 953 1490 3.0E-47
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 955 1476 3.0E-47
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 958 1501 8.0E-47
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 954 1472 1.0E-46
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 948 1474 2.0E-46
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 985 1476 2.0E-46
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 957 1472 8.0E-46
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 957 1472 1.0E-45
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 985 1457 2.0E-45
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 955 1490 2.0E-45
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 955 1472 3.0E-45
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 985 1457 3.0E-45
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 954 1491 6.0E-45
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 985 1467 6.0E-45
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 938 1490 6.0E-45
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 958 1474 7.0E-45
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 938 1490 7.0E-45
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 928 1472 1.0E-44
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 928 1472 1.0E-44
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 949 1490 2.0E-44
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 928 1472 3.0E-44
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 928 1472 4.0E-44
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 928 1472 5.0E-44
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 928 1472 5.0E-44
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 954 1474 6.0E-44
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 955 1472 6.0E-44
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 985 1457 3.0E-43
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 985 1457 3.0E-43
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 955 1472 5.0E-43
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 955 1490 5.0E-43
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 941 1490 1.0E-42
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 954 1472 1.0E-42
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 953 1490 1.0E-42
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 954 1491 2.0E-42
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 954 1491 2.0E-42
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 944 1490 2.0E-42
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 957 1467 4.0E-42
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 957 1490 4.0E-42
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 957 1490 4.0E-42
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 918 1474 4.0E-42
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 958 1472 5.0E-42
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 938 1490 9.0E-42
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 949 1474 1.0E-41
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 957 1490 1.0E-41
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 954 1467 1.0E-41
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 958 1490 2.0E-41
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 949 1474 2.0E-41
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 957 1490 2.0E-41
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 953 1472 2.0E-41
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 925 1472 2.0E-41
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 949 1474 2.0E-41
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 957 1490 3.0E-41
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 958 1472 3.0E-41
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 938 1490 3.0E-41
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 957 1490 3.0E-41
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 954 1472 4.0E-41
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 961 1521 6.0E-41
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 985 1476 8.0E-41
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 949 1474 2.0E-40
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 957 1491 4.0E-40
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 957 1471 9.0E-40
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 957 1472 1.0E-39
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 961 1490 2.0E-38
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 961 1476 2.0E-38
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 958 1473 3.0E-38
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 958 1260 4.0E-38
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 957 1472 7.0E-38
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 961 1514 7.0E-38
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 954 1476 1.0E-37
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 954 1474 1.0E-37
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 955 1473 2.0E-37
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 901 1472 2.0E-37
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 954 1490 3.0E-37
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 955 1570 7.0E-37
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 957 1467 1.0E-36
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 983 1491 2.0E-36
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 955 1495 3.0E-36
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 958 1472 4.0E-36
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 958 1472 9.0E-36
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 957 1493 5.0E-35
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 958 1471 9.0E-34
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 983 1455 2.0E-32
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 958 1472 9.0E-31
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 955 1490 5.0E-30
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 958 1456 2.0E-29
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 968 1488 2.0E-28
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 1316 1475 3.0E-28
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 1316 1475 3.0E-28
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 1316 1475 3.0E-28
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 1324 1475 1.0E-27
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 961 1515 1.0E-27
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 1342 1596 1.0E-26
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 983 1447 3.0E-26
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 1288 1489 6.0E-26
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 1310 1549 2.0E-25
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 1288 1489 5.0E-25
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 1327 1489 2.0E-24
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 1324 1464 8.0E-24
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 1326 1493 1.0E-23
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 1266 1472 1.0E-23
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 1300 1499 2.0E-23
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 983 1448 2.0E-23
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 983 1448 2.0E-23
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 1333 1472 3.0E-23
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 957 1489 3.0E-23
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 981 1448 3.0E-23
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 1326 1497 5.0E-23
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 1326 1489 6.0E-23
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 976 1489 6.0E-23
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 1333 1472 6.0E-23
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 1333 1472 8.0E-23
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 1333 1472 8.0E-23
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 1333 1472 8.0E-23
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 1333 1472 8.0E-23
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 1326 1474 9.0E-23
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 1326 1536 1.0E-22
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 1333 1472 1.0E-22
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 974 1448 2.0E-22
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 1333 1472 2.0E-22
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 1326 1472 2.0E-22
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 1326 1472 2.0E-22
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 1326 1514 3.0E-22
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 1326 1472 3.0E-22
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 1333 1472 4.0E-22
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 1326 1489 4.0E-22
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 1326 1489 5.0E-22
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 1313 1529 5.0E-22
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 1313 1529 5.0E-22
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 930 1276 5.0E-22
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 1285 1472 5.0E-22
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 982 1447 5.0E-22
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 1326 1489 6.0E-22
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 1326 1489 6.0E-22
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 1326 1500 9.0E-22
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 1343 1483 1.0E-21
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 1326 1472 1.0E-21
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 1343 1472 1.0E-21
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 1326 1495 1.0E-21
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 1330 1473 2.0E-21
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 1326 1472 2.0E-21
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 1319 1472 2.0E-21
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 1324 1475 3.0E-21
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 961 1474 3.0E-21
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 1324 1522 4.0E-21
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 1324 1494 4.0E-21
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 1333 1479 7.0E-21
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 1324 1472 1.0E-20
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 1343 1483 1.0E-20
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 1324 1472 2.0E-20
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 1326 1472 3.0E-20
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 1328 1475 3.0E-20
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 1328 1475 3.0E-20
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 1324 1475 4.0E-20
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 1327 1472 5.0E-20
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 982 1474 5.0E-20
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 1319 1475 6.0E-20
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 1341 1479 3.0E-19
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 985 1457 7.0E-19
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 962 1461 1.0E-18
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 985 1276 2.0E-18
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 962 1461 2.0E-18
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 1324 1457 6.0E-18
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 1324 1457 6.0E-18
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 1342 1457 8.0E-18
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 1342 1469 1.0E-17
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 1340 1488 3.0E-17
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 958 1276 4.0E-17
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 961 1276 2.0E-16
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 985 1276 2.0E-16
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 874 1276 2.0E-16
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 985 1279 2.0E-16
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 1324 1457 2.0E-16
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 957 1276 3.0E-16
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 1319 1457 4.0E-16
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 957 1276 6.0E-16
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 957 1276 7.0E-16
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 957 1276 8.0E-16
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 957 1276 9.0E-16
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 985 1279 2.0E-15
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 957 1276 3.0E-15
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 957 1292 4.0E-15
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 958 1276 6.0E-15
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 1327 1469 6.0E-15
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 966 1276 7.0E-15
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 1342 1457 7.0E-15
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 985 1276 1.0E-14
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 957 1276 1.0E-14
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 957 1276 1.0E-14
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 958 1276 1.0E-14
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 1343 1477 1.0E-14
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 985 1307 2.0E-14
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 985 1307 2.0E-14
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 957 1276 6.0E-14
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 1343 1457 7.0E-14
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 1343 1469 7.0E-14
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 1340 1457 9.0E-14
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 958 1276 1.0E-13
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 957 1276 1.0E-13
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 1343 1469 1.0E-13
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 957 1276 2.0E-13
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 957 1276 2.0E-13
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 958 1276 2.0E-13
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 958 1276 2.0E-13
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 958 1276 2.0E-13
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 1343 1457 2.0E-13
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 957 1276 3.0E-13
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 958 1335 3.0E-13
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 1324 1487 3.0E-13
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 983 1337 5.0E-13
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 1341 1457 5.0E-13
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 1340 1457 7.0E-13
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 985 1276 8.0E-13
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 957 1276 1.0E-12
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 961 1170 1.0E-12
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 1329 1471 1.0E-12
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 985 1276 2.0E-12
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 985 1276 2.0E-12
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 985 1276 2.0E-12
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 985 1276 2.0E-12
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 958 1276 2.0E-12
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 958 1276 2.0E-12
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 928 1170 2.0E-12
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 958 1276 3.0E-12
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 1329 1509 4.0E-12
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 1341 1457 4.0E-12
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 1324 1457 5.0E-12
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 1326 1457 5.0E-12
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 985 1276 7.0E-12
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 958 1282 8.0E-12
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 962 1471 8.0E-12
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 985 1279 9.0E-12
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 958 1276 1.0E-11
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 1324 1457 1.0E-11
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 1324 1457 1.0E-11
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 985 1276 2.0E-11
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 1341 1457 2.0E-11
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 1343 1454 2.0E-11
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 902 1276 3.0E-11
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 1342 1457 3.0E-11
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 985 1276 4.0E-11
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 1303 1461 1.0E-10
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 958 1276 2.0E-10
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 1328 1473 3.0E-10
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 985 1282 4.0E-10
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 983 1337 6.0E-10
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 1343 1474 6.0E-10
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 1329 1457 9.0E-10
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 1329 1457 1.0E-09
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 1333 1457 2.0E-09
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 1329 1479 2.0E-09
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 1329 1457 3.0E-09
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 1343 1471 5.0E-09
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 1003 1293 8.0E-09
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 1333 1457 9.0E-09
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 1340 1471 9.0E-09
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 1343 1491 3.0E-08
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 975 1228 9.0E-08
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 1343 1491 9.0E-08
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 982 1185 2.0E-07
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 943 1280 2.0E-07
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 982 1272 3.0E-06
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 1343 1464 3.0E-06
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 1530 1688 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3369
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2853
Ophiocordyceps australis map64 (Brazil) OphauB2|184 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05091
Ophiocordyceps camponoti-rufipedis Ophun1|4259
Ophiocordyceps kimflemingae Ophio5|658
Ophiocordyceps subramaniannii Hirsu2|629

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|184
MGGSGCQDPFEWDVGAVADALCSLERPCAQDLIAFRAKLHEHEVDGFTLLTFEYVCSRPELFETLGIRLGCYKAA
LGYAILQLRAKSPQFRRWKIAALSELDESNGPLVDAPPTDMVNGLGQRMPPGPESVGEQHPLPRNKRKHEAMETG
SKTPGAQDQDALQNKRRQRDTEMGQHRFDTPTPSAPAMSPVPTVQTSRHNAPAEAGGSVLSPQTNQNTEKGLKRK
RVAPLQLSDSVGHLSSFESDFEVPALRLEANTPRRSLSDQDGTFPWEKPMPYSYLGAGILSTSAVRSPHGALNTQ
VCERAVGDGNFYIKFPSISPPGLRIVINRVMQRHLIKNSNREDLLRQGLVPTRTNTPDEDESIDIFDLPDEWDEE
TLRAIEQDRMEEQEEMEGCVPKERVQALLQEATDAFKTTWEETKLPKHQRKAYKMWTSAQRQGTRSHQILTARFR
AKECDRRLKNQQSEILGQRWEREAEVTCQAMIMEQNLSDKLYHQWLAEMLESRTEPLGPASLPKPKERPTVRRPV
LKDTEVLSSSDDDDFIVDDEPEEPVQDDGPLHMDHNMEEDVGGHVHPVEDGGVASRVEMMDPRDETPEWPDSHSI
VDLTGLDSSPEPSPRRGRDSLVIDLTTPNRSRDGRPPPLETRLNTPDFEQAPLQEPQDEPQGVPQEMPNQVAQKE
EISQEVPQEVLNKIIQQVSQEILQDTPQEVSGEAPGDPPKKAPSSLWDVAEIGRYSPKHWAKAKDGPRLVISLLW
RMGHIRRAPIFDSARESSADELFLTTIESHLADPVTDNYALAVDMIWIFLAYIKAQNCARERILNISSKRAKLLR
RSGEQWQEFYDFLNDIAVEFPLDSQIFRSDSLGELDDFDDEMDDDEALSDSQAHGTQTRKNAPREIVRNREALDL
RERERRRLEEQEARRAKLRATLDAHGIMSQDESRLIINEAKQDDQAFVYVNREAGERIKDHQIDGVRFLWNQSIL
VDASMRQGCLLSHTMGLGKTMQVITFLVAVQECAQSSDPAVRSQIAEDLRLSKTLVICPAGLVDNWLDEFLIWVP
EASQLLGPIRKISADMRPEERLQIINAWAEEGGVLIIGYNLFKKLAAEDGDVEKPVLLNTPNIVIADEAHLLKSP
KTAVHQVSSRFRTNCRIALTGSPLANNVKEYFSMINWVAPMYLGEYSEFRGIYENPIHTGFWSDSTRAQKRKALT
MLRVLSETVAPKVHRRTIQCLRSDLPPKQEFILFVPLGELQCSLYNLYIEGIDAGKTQHLTALENLRLLCNHPRC
FREKAAQDRKTRQNFPEDEASAQSLIPENIISTILKLTKTADIDNANLSIKAQLLVMILDEARLAHDKVLVFSQS
IPTLDYLSNLLHMQRRRVCRLDGSTTIRKRQEMVKNFNEGDQEVYLISTTAGGVGLNIQGANRVVIYDFGWNPVH
DQQAVGRAYRLGQEKPVFVYRFVVVGTFEEHLNNKAVYKMQLAARVVDKKNPISFSKKHLSDLLQVPVPKPAEPL
DEFVGRDHILDKLIKFKSNGEAIRWIVSTDTFEEEDPTDKLTAEERRDAEELAKLNRLRLVDPAEYGRRLEEDRA
KQLMLRLYNAVDEAMPNDGFGQTVAPVQPVLAAMPQMSRVVVPTYHAPQDAAFQDGRALGFNPPQYPTFNLPQDP
TFHQLQDAAFHQPHGPAFHQPRGLAFHHARAPALHPPQAPMVAPTETAPTMRAPLADASLVSPLVATTDAMPVTD
ANATEIPAPAEPGHVPGPDSSIIPAAEAPAVPQPDEANTTAPVTAVAVEIEDPRDKAQSTCTPAVAPVPVMGTNT
YFGERNEAEQEPSIPKPSTPMPSTPKPSHSVMSNGSPVKNLFFPCRDSGRRQFEEMLLDKLKELQEDGVSGVVGD
RDCIVKIAEEIENCRKGKEFGFIPDMAQWRMLREFSKNKTFALATVSAHFSPSFLALGQREDFEKRLSALEQSSN
GQMQIELASGTRMKDPGNLRNLGRSPGTQGSPRAKEDERVMREAAERRRQRFAQHAATSIPWTKDTVSDGNGTAF
GENK*
Coding >OphauB2|184
ATGGGGGGCTCAGGGTGCCAAGACCCCTTTGAATGGGACGTTGGCGCTGTTGCAGATGCGCTCTGCTCTCTGGAA
CGACCGTGCGCTCAAGATCTCATTGCCTTTAGGGCAAAGCTCCATGAGCATGAAGTAGACGGCTTTACCCTGCTT
ACCTTTGAGTATGTATGCTCGAGGCCTGAGCTTTTTGAGACTTTGGGCATCAGGCTTGGCTGTTACAAGGCTGCG
CTGGGCTATGCCATCTTGCAACTGAGGGCCAAGAGCCCGCAGTTTCGACGGTGGAAGATTGCTGCTCTAAGCGAG
CTTGATGAGTCAAATGGCCCTCTTGTCGATGCCCCGCCCACCGACATGGTGAATGGGCTTGGGCAAAGAATGCCG
CCGGGCCCAGAGTCTGTAGGCGAGCAGCATCCTCTGCCGCGGAATAAACGCAAACATGAGGCCATGGAGACGGGT
TCCAAGACGCCAGGGGCTCAAGACCAGGATGCACTACAGAATAAACGGAGGCAGCGGGATACTGAGATGGGACAA
CATCGTTTCGACACTCCTACTCCTTCCGCGCCGGCCATGAGCCCTGTCCCAACTGTCCAAACCAGCCGCCACAAT
GCTCCCGCAGAAGCTGGGGGTTCCGTCTTGAGTCCTCAAACGAATCAAAATACTGAAAAGGGTTTGAAACGAAAA
AGAGTTGCGCCGCTTCAGCTCTCTGACTCTGTCGGACATCTTTCTAGCTTTGAGTCCGACTTTGAAGTGCCAGCA
CTCCGGCTAGAGGCCAATACTCCAAGAAGAAGCCTCTCTGATCAAGATGGAACTTTTCCCTGGGAAAAGCCCATG
CCATATAGTTACTTGGGGGCAGGCATCTTGTCAACATCTGCGGTCCGGTCTCCCCATGGCGCTCTCAACACCCAG
GTTTGCGAGAGAGCTGTTGGCGATGGCAACTTTTACATTAAATTCCCTTCTATATCTCCACCTGGCTTGCGGATA
GTAATTAATCGGGTGATGCAACGACACTTGATTAAAAATAGTAACCGCGAAGACTTGCTTCGCCAAGGCTTGGTG
CCCACGCGCACGAATACCCCGGATGAAGACGAATCAATCGACATATTCGACTTGCCGGATGAATGGGATGAGGAG
ACCCTCCGAGCTATAGAGCAAGACAGGATGGAAGAGCAAGAAGAAATGGAGGGATGCGTTCCCAAGGAGCGGGTG
CAAGCGTTGCTCCAAGAAGCCACCGACGCCTTCAAGACAACATGGGAAGAGACAAAACTACCCAAGCATCAACGC
AAGGCTTACAAGATGTGGACGAGCGCCCAGAGGCAGGGTACTCGAAGCCACCAAATCCTGACTGCGCGCTTTCGA
GCCAAAGAATGCGACAGGCGTCTCAAGAACCAGCAATCTGAGATTCTTGGACAGAGATGGGAAAGGGAAGCCGAG
GTTACCTGCCAAGCCATGATTATGGAGCAGAATCTCAGCGACAAGCTTTACCATCAATGGCTTGCCGAGATGCTG
GAGTCACGCACCGAGCCTCTCGGGCCTGCTAGTCTTCCAAAGCCCAAGGAACGACCCACGGTCCGCAGACCGGTG
CTCAAGGACACTGAAGTCTTGAGCAGCTCAGACGATGACGATTTCATTGTCGATGATGAGCCAGAGGAGCCAGTG
CAAGACGACGGTCCGTTGCATATGGACCATAACATGGAGGAGGACGTGGGCGGCCATGTGCATCCTGTTGAAGAT
GGTGGTGTTGCAAGTCGAGTCGAGATGATGGACCCAAGGGATGAGACCCCAGAATGGCCCGATTCACATAGTATT
GTGGATCTGACTGGTCTGGATAGTAGTCCAGAGCCGTCGCCGAGACGAGGCCGTGATTCACTGGTTATTGACTTG
ACGACTCCAAACAGATCTAGAGATGGGCGTCCGCCGCCATTGGAAACTCGTCTGAATACTCCAGATTTTGAACAG
GCTCCTCTACAAGAGCCGCAGGACGAGCCTCAGGGCGTGCCTCAAGAGATGCCTAATCAAGTTGCTCAAAAAGAA
GAGATTTCTCAAGAAGTGCCTCAAGAGGTGCTTAATAAAATTATTCAACAAGTATCTCAAGAGATTCTTCAAGAC
ACACCCCAAGAGGTGTCTGGAGAAGCGCCTGGGGACCCTCCTAAAAAGGCGCCTTCAAGCTTGTGGGATGTTGCC
GAGATTGGTCGCTATAGTCCGAAACATTGGGCCAAAGCCAAAGATGGCCCGCGGCTGGTCATATCACTACTCTGG
AGGATGGGCCATATACGCCGTGCTCCAATTTTCGATTCGGCCCGAGAAAGCTCTGCCGATGAACTATTTCTTACA
ACAATAGAGAGTCATCTCGCAGATCCTGTCACGGACAATTATGCATTGGCAGTGGACATGATTTGGATCTTCCTT
GCCTACATCAAGGCGCAAAACTGTGCACGCGAACGAATCCTCAACATATCCTCAAAGAGAGCCAAGCTTCTTCGT
CGCTCAGGTGAACAGTGGCAAGAGTTTTATGACTTTCTCAACGACATTGCCGTCGAATTCCCTCTAGACAGCCAA
ATCTTTCGGTCCGATAGTCTCGGCGAACTCGACGACTTTGATGATGAAATGGACGACGACGAAGCCCTTTCTGAC
AGCCAGGCTCACGGGACGCAAACTCGAAAGAATGCACCTAGAGAAATCGTACGTAATAGAGAAGCTTTGGATCTA
AGAGAGCGAGAGCGGCGTCGACTCGAGGAGCAGGAAGCCCGGCGAGCCAAGCTTAGAGCCACTCTGGATGCCCAT
GGTATCATGTCTCAAGATGAGTCCCGACTCATCATCAACGAAGCCAAGCAAGACGATCAGGCTTTTGTATACGTC
AACAGGGAAGCTGGAGAGCGTATCAAGGACCACCAGATTGACGGCGTGCGCTTCCTCTGGAACCAATCGATTCTT
GTTGACGCAAGCATGCGTCAAGGCTGTCTCCTTTCGCATACCATGGGCTTGGGCAAAACTATGCAAGTCATTACT
TTTCTTGTCGCAGTGCAAGAATGCGCACAGTCGTCAGACCCGGCTGTCCGTTCTCAGATAGCTGAAGACTTGAGA
TTGTCCAAGACATTGGTTATATGCCCCGCTGGGCTCGTGGACAATTGGTTGGATGAGTTCCTCATCTGGGTGCCC
GAAGCAAGTCAACTGCTTGGTCCCATTCGCAAGATTTCAGCAGATATGCGGCCTGAAGAGCGTCTTCAGATAATC
AATGCTTGGGCTGAAGAAGGAGGCGTCTTAATCATTGGCTACAACTTGTTCAAAAAGCTGGCAGCCGAGGATGGA
GATGTCGAGAAGCCTGTGTTGCTTAATACTCCCAACATTGTCATTGCCGATGAAGCTCATCTCCTCAAAAGCCCC
AAGACGGCAGTACACCAAGTTTCCTCGCGATTTCGGACTAACTGCCGCATCGCTCTGACTGGGTCGCCTTTGGCC
AACAATGTCAAGGAGTACTTCTCCATGATCAACTGGGTGGCCCCCATGTATCTGGGTGAATATAGCGAATTTCGG
GGAATTTACGAAAATCCTATTCACACTGGATTTTGGAGCGATAGCACCAGGGCACAAAAGAGAAAAGCACTCACC
ATGCTGCGCGTTCTCAGCGAGACAGTTGCACCAAAGGTTCACCGGAGGACCATTCAATGCCTCAGAAGCGACTTG
CCGCCCAAGCAAGAGTTCATCTTGTTTGTTCCACTGGGCGAATTGCAGTGCAGCCTCTACAACCTGTACATTGAG
GGTATCGACGCGGGAAAAACTCAGCACCTTACGGCTCTTGAAAACCTGAGGCTATTGTGTAACCATCCACGCTGC
TTTCGCGAAAAGGCTGCACAAGACCGGAAAACACGCCAGAATTTTCCAGAAGACGAAGCGTCGGCACAGAGTCTA
ATTCCAGAAAACATCATTTCCACCATTCTCAAGCTAACAAAGACGGCAGACATTGACAATGCAAACTTGTCCATC
AAGGCGCAGCTGCTGGTTATGATTCTGGACGAGGCTCGACTTGCACATGACAAGGTGCTCGTCTTTAGCCAGTCG
ATTCCGACATTGGATTACCTGTCAAATCTTTTGCATATGCAGCGGCGTCGGGTTTGCCGGTTGGATGGCTCAACG
ACAATTCGCAAGCGGCAAGAAATGGTCAAGAACTTCAACGAGGGCGATCAAGAAGTTTACTTGATCTCAACCACT
GCTGGCGGCGTCGGACTCAACATCCAAGGCGCCAATCGAGTCGTAATATACGACTTTGGATGGAATCCCGTCCAT
GATCAGCAAGCAGTTGGAAGAGCCTATCGTCTTGGACAGGAGAAGCCAGTTTTTGTATACCGATTTGTCGTTGTT
GGCACTTTTGAGGAGCACTTGAACAACAAGGCTGTTTACAAGATGCAGTTGGCTGCGCGAGTCGTTGACAAGAAG
AATCCAATAAGTTTTTCCAAGAAGCACTTAAGCGACTTGCTTCAAGTGCCCGTGCCAAAACCTGCCGAGCCGCTG
GATGAATTCGTCGGACGGGACCACATTCTCGACAAGCTCATCAAGTTCAAGAGTAATGGCGAGGCGATTCGATGG
ATAGTCTCGACGGATACGTTTGAAGAGGAGGACCCAACAGACAAGCTGACGGCTGAGGAGCGCCGAGACGCCGAG
GAGCTGGCAAAGCTGAATCGTTTGCGCTTGGTGGATCCGGCGGAATATGGAAGACGGCTCGAGGAGGACAGGGCA
AAGCAGCTGATGCTTCGCCTTTATAACGCTGTGGATGAGGCTATGCCCAACGATGGATTTGGGCAGACTGTTGCA
CCGGTTCAGCCCGTGCTTGCGGCAATGCCCCAAATGTCGAGAGTTGTGGTTCCAACTTATCATGCACCGCAGGAT
GCAGCTTTTCAAGACGGCCGGGCTCTAGGCTTTAATCCGCCTCAGTATCCAACTTTTAATCTGCCTCAGGATCCA
ACTTTTCATCAGCTTCAGGATGCAGCTTTTCATCAGCCACATGGCCCAGCTTTTCATCAGCCTCGTGGTCTAGCT
TTCCATCACGCTCGAGCTCCAGCTTTGCATCCACCTCAGGCCCCAATGGTGGCTCCAACGGAGACTGCTCCAACT
ATGCGAGCTCCTCTTGCAGATGCTTCGCTTGTTAGCCCTCTTGTGGCGACCACGGACGCAATGCCTGTTACAGAC
GCAAACGCGACCGAGATACCAGCGCCCGCAGAGCCAGGGCATGTGCCCGGTCCAGATTCAAGCATAATTCCAGCA
GCAGAAGCACCAGCGGTGCCGCAGCCGGATGAAGCGAATACAACGGCGCCTGTGACGGCAGTGGCAGTGGAAATA
GAGGATCCAAGGGATAAAGCGCAGAGCACATGCACGCCAGCAGTTGCTCCAGTGCCAGTCATGGGGACCAATACA
TACTTTGGTGAGAGAAATGAGGCTGAGCAAGAGCCATCAATTCCCAAGCCATCTACACCCATGCCATCAACTCCC
AAGCCATCACACTCTGTCATGTCAAATGGTTCGCCGGTAAAAAACCTCTTTTTCCCATGTCGCGATTCAGGAAGA
CGCCAGTTTGAAGAGATGCTGCTTGACAAGCTCAAGGAGCTCCAAGAGGACGGGGTTTCGGGCGTCGTGGGCGAC
AGAGACTGCATTGTCAAGATTGCGGAAGAAATTGAAAATTGCCGAAAGGGTAAAGAGTTTGGGTTCATTCCAGAC
ATGGCTCAATGGCGGATGCTTAGAGAGTTTTCCAAGAACAAGACCTTTGCGCTGGCGACTGTTTCTGCACACTTT
TCGCCCTCGTTTCTTGCCCTGGGGCAACGAGAGGACTTTGAAAAGCGATTGTCGGCGTTGGAGCAGTCATCTAAT
GGCCAAATGCAGATCGAGCTAGCCTCTGGAACCAGGATGAAGGATCCCGGAAACCTTCGAAACCTGGGCCGTTCG
CCTGGGACTCAAGGCTCACCTCGGGCCAAGGAAGATGAGAGGGTGATGCGTGAGGCGGCTGAAAGAAGACGGCAG
CGATTTGCTCAACATGCAGCTACTAGTATTCCTTGGACAAAGGACACAGTTTCGGATGGCAATGGCACGGCGTTT
GGAGAGAATAAATGA
Transcript >OphauB2|184
ATGGGGGGCTCAGGGTGCCAAGACCCCTTTGAATGGGACGTTGGCGCTGTTGCAGATGCGCTCTGCTCTCTGGAA
CGACCGTGCGCTCAAGATCTCATTGCCTTTAGGGCAAAGCTCCATGAGCATGAAGTAGACGGCTTTACCCTGCTT
ACCTTTGAGTATGTATGCTCGAGGCCTGAGCTTTTTGAGACTTTGGGCATCAGGCTTGGCTGTTACAAGGCTGCG
CTGGGCTATGCCATCTTGCAACTGAGGGCCAAGAGCCCGCAGTTTCGACGGTGGAAGATTGCTGCTCTAAGCGAG
CTTGATGAGTCAAATGGCCCTCTTGTCGATGCCCCGCCCACCGACATGGTGAATGGGCTTGGGCAAAGAATGCCG
CCGGGCCCAGAGTCTGTAGGCGAGCAGCATCCTCTGCCGCGGAATAAACGCAAACATGAGGCCATGGAGACGGGT
TCCAAGACGCCAGGGGCTCAAGACCAGGATGCACTACAGAATAAACGGAGGCAGCGGGATACTGAGATGGGACAA
CATCGTTTCGACACTCCTACTCCTTCCGCGCCGGCCATGAGCCCTGTCCCAACTGTCCAAACCAGCCGCCACAAT
GCTCCCGCAGAAGCTGGGGGTTCCGTCTTGAGTCCTCAAACGAATCAAAATACTGAAAAGGGTTTGAAACGAAAA
AGAGTTGCGCCGCTTCAGCTCTCTGACTCTGTCGGACATCTTTCTAGCTTTGAGTCCGACTTTGAAGTGCCAGCA
CTCCGGCTAGAGGCCAATACTCCAAGAAGAAGCCTCTCTGATCAAGATGGAACTTTTCCCTGGGAAAAGCCCATG
CCATATAGTTACTTGGGGGCAGGCATCTTGTCAACATCTGCGGTCCGGTCTCCCCATGGCGCTCTCAACACCCAG
GTTTGCGAGAGAGCTGTTGGCGATGGCAACTTTTACATTAAATTCCCTTCTATATCTCCACCTGGCTTGCGGATA
GTAATTAATCGGGTGATGCAACGACACTTGATTAAAAATAGTAACCGCGAAGACTTGCTTCGCCAAGGCTTGGTG
CCCACGCGCACGAATACCCCGGATGAAGACGAATCAATCGACATATTCGACTTGCCGGATGAATGGGATGAGGAG
ACCCTCCGAGCTATAGAGCAAGACAGGATGGAAGAGCAAGAAGAAATGGAGGGATGCGTTCCCAAGGAGCGGGTG
CAAGCGTTGCTCCAAGAAGCCACCGACGCCTTCAAGACAACATGGGAAGAGACAAAACTACCCAAGCATCAACGC
AAGGCTTACAAGATGTGGACGAGCGCCCAGAGGCAGGGTACTCGAAGCCACCAAATCCTGACTGCGCGCTTTCGA
GCCAAAGAATGCGACAGGCGTCTCAAGAACCAGCAATCTGAGATTCTTGGACAGAGATGGGAAAGGGAAGCCGAG
GTTACCTGCCAAGCCATGATTATGGAGCAGAATCTCAGCGACAAGCTTTACCATCAATGGCTTGCCGAGATGCTG
GAGTCACGCACCGAGCCTCTCGGGCCTGCTAGTCTTCCAAAGCCCAAGGAACGACCCACGGTCCGCAGACCGGTG
CTCAAGGACACTGAAGTCTTGAGCAGCTCAGACGATGACGATTTCATTGTCGATGATGAGCCAGAGGAGCCAGTG
CAAGACGACGGTCCGTTGCATATGGACCATAACATGGAGGAGGACGTGGGCGGCCATGTGCATCCTGTTGAAGAT
GGTGGTGTTGCAAGTCGAGTCGAGATGATGGACCCAAGGGATGAGACCCCAGAATGGCCCGATTCACATAGTATT
GTGGATCTGACTGGTCTGGATAGTAGTCCAGAGCCGTCGCCGAGACGAGGCCGTGATTCACTGGTTATTGACTTG
ACGACTCCAAACAGATCTAGAGATGGGCGTCCGCCGCCATTGGAAACTCGTCTGAATACTCCAGATTTTGAACAG
GCTCCTCTACAAGAGCCGCAGGACGAGCCTCAGGGCGTGCCTCAAGAGATGCCTAATCAAGTTGCTCAAAAAGAA
GAGATTTCTCAAGAAGTGCCTCAAGAGGTGCTTAATAAAATTATTCAACAAGTATCTCAAGAGATTCTTCAAGAC
ACACCCCAAGAGGTGTCTGGAGAAGCGCCTGGGGACCCTCCTAAAAAGGCGCCTTCAAGCTTGTGGGATGTTGCC
GAGATTGGTCGCTATAGTCCGAAACATTGGGCCAAAGCCAAAGATGGCCCGCGGCTGGTCATATCACTACTCTGG
AGGATGGGCCATATACGCCGTGCTCCAATTTTCGATTCGGCCCGAGAAAGCTCTGCCGATGAACTATTTCTTACA
ACAATAGAGAGTCATCTCGCAGATCCTGTCACGGACAATTATGCATTGGCAGTGGACATGATTTGGATCTTCCTT
GCCTACATCAAGGCGCAAAACTGTGCACGCGAACGAATCCTCAACATATCCTCAAAGAGAGCCAAGCTTCTTCGT
CGCTCAGGTGAACAGTGGCAAGAGTTTTATGACTTTCTCAACGACATTGCCGTCGAATTCCCTCTAGACAGCCAA
ATCTTTCGGTCCGATAGTCTCGGCGAACTCGACGACTTTGATGATGAAATGGACGACGACGAAGCCCTTTCTGAC
AGCCAGGCTCACGGGACGCAAACTCGAAAGAATGCACCTAGAGAAATCGTACGTAATAGAGAAGCTTTGGATCTA
AGAGAGCGAGAGCGGCGTCGACTCGAGGAGCAGGAAGCCCGGCGAGCCAAGCTTAGAGCCACTCTGGATGCCCAT
GGTATCATGTCTCAAGATGAGTCCCGACTCATCATCAACGAAGCCAAGCAAGACGATCAGGCTTTTGTATACGTC
AACAGGGAAGCTGGAGAGCGTATCAAGGACCACCAGATTGACGGCGTGCGCTTCCTCTGGAACCAATCGATTCTT
GTTGACGCAAGCATGCGTCAAGGCTGTCTCCTTTCGCATACCATGGGCTTGGGCAAAACTATGCAAGTCATTACT
TTTCTTGTCGCAGTGCAAGAATGCGCACAGTCGTCAGACCCGGCTGTCCGTTCTCAGATAGCTGAAGACTTGAGA
TTGTCCAAGACATTGGTTATATGCCCCGCTGGGCTCGTGGACAATTGGTTGGATGAGTTCCTCATCTGGGTGCCC
GAAGCAAGTCAACTGCTTGGTCCCATTCGCAAGATTTCAGCAGATATGCGGCCTGAAGAGCGTCTTCAGATAATC
AATGCTTGGGCTGAAGAAGGAGGCGTCTTAATCATTGGCTACAACTTGTTCAAAAAGCTGGCAGCCGAGGATGGA
GATGTCGAGAAGCCTGTGTTGCTTAATACTCCCAACATTGTCATTGCCGATGAAGCTCATCTCCTCAAAAGCCCC
AAGACGGCAGTACACCAAGTTTCCTCGCGATTTCGGACTAACTGCCGCATCGCTCTGACTGGGTCGCCTTTGGCC
AACAATGTCAAGGAGTACTTCTCCATGATCAACTGGGTGGCCCCCATGTATCTGGGTGAATATAGCGAATTTCGG
GGAATTTACGAAAATCCTATTCACACTGGATTTTGGAGCGATAGCACCAGGGCACAAAAGAGAAAAGCACTCACC
ATGCTGCGCGTTCTCAGCGAGACAGTTGCACCAAAGGTTCACCGGAGGACCATTCAATGCCTCAGAAGCGACTTG
CCGCCCAAGCAAGAGTTCATCTTGTTTGTTCCACTGGGCGAATTGCAGTGCAGCCTCTACAACCTGTACATTGAG
GGTATCGACGCGGGAAAAACTCAGCACCTTACGGCTCTTGAAAACCTGAGGCTATTGTGTAACCATCCACGCTGC
TTTCGCGAAAAGGCTGCACAAGACCGGAAAACACGCCAGAATTTTCCAGAAGACGAAGCGTCGGCACAGAGTCTA
ATTCCAGAAAACATCATTTCCACCATTCTCAAGCTAACAAAGACGGCAGACATTGACAATGCAAACTTGTCCATC
AAGGCGCAGCTGCTGGTTATGATTCTGGACGAGGCTCGACTTGCACATGACAAGGTGCTCGTCTTTAGCCAGTCG
ATTCCGACATTGGATTACCTGTCAAATCTTTTGCATATGCAGCGGCGTCGGGTTTGCCGGTTGGATGGCTCAACG
ACAATTCGCAAGCGGCAAGAAATGGTCAAGAACTTCAACGAGGGCGATCAAGAAGTTTACTTGATCTCAACCACT
GCTGGCGGCGTCGGACTCAACATCCAAGGCGCCAATCGAGTCGTAATATACGACTTTGGATGGAATCCCGTCCAT
GATCAGCAAGCAGTTGGAAGAGCCTATCGTCTTGGACAGGAGAAGCCAGTTTTTGTATACCGATTTGTCGTTGTT
GGCACTTTTGAGGAGCACTTGAACAACAAGGCTGTTTACAAGATGCAGTTGGCTGCGCGAGTCGTTGACAAGAAG
AATCCAATAAGTTTTTCCAAGAAGCACTTAAGCGACTTGCTTCAAGTGCCCGTGCCAAAACCTGCCGAGCCGCTG
GATGAATTCGTCGGACGGGACCACATTCTCGACAAGCTCATCAAGTTCAAGAGTAATGGCGAGGCGATTCGATGG
ATAGTCTCGACGGATACGTTTGAAGAGGAGGACCCAACAGACAAGCTGACGGCTGAGGAGCGCCGAGACGCCGAG
GAGCTGGCAAAGCTGAATCGTTTGCGCTTGGTGGATCCGGCGGAATATGGAAGACGGCTCGAGGAGGACAGGGCA
AAGCAGCTGATGCTTCGCCTTTATAACGCTGTGGATGAGGCTATGCCCAACGATGGATTTGGGCAGACTGTTGCA
CCGGTTCAGCCCGTGCTTGCGGCAATGCCCCAAATGTCGAGAGTTGTGGTTCCAACTTATCATGCACCGCAGGAT
GCAGCTTTTCAAGACGGCCGGGCTCTAGGCTTTAATCCGCCTCAGTATCCAACTTTTAATCTGCCTCAGGATCCA
ACTTTTCATCAGCTTCAGGATGCAGCTTTTCATCAGCCACATGGCCCAGCTTTTCATCAGCCTCGTGGTCTAGCT
TTCCATCACGCTCGAGCTCCAGCTTTGCATCCACCTCAGGCCCCAATGGTGGCTCCAACGGAGACTGCTCCAACT
ATGCGAGCTCCTCTTGCAGATGCTTCGCTTGTTAGCCCTCTTGTGGCGACCACGGACGCAATGCCTGTTACAGAC
GCAAACGCGACCGAGATACCAGCGCCCGCAGAGCCAGGGCATGTGCCCGGTCCAGATTCAAGCATAATTCCAGCA
GCAGAAGCACCAGCGGTGCCGCAGCCGGATGAAGCGAATACAACGGCGCCTGTGACGGCAGTGGCAGTGGAAATA
GAGGATCCAAGGGATAAAGCGCAGAGCACATGCACGCCAGCAGTTGCTCCAGTGCCAGTCATGGGGACCAATACA
TACTTTGGTGAGAGAAATGAGGCTGAGCAAGAGCCATCAATTCCCAAGCCATCTACACCCATGCCATCAACTCCC
AAGCCATCACACTCTGTCATGTCAAATGGTTCGCCGGTAAAAAACCTCTTTTTCCCATGTCGCGATTCAGGAAGA
CGCCAGTTTGAAGAGATGCTGCTTGACAAGCTCAAGGAGCTCCAAGAGGACGGGGTTTCGGGCGTCGTGGGCGAC
AGAGACTGCATTGTCAAGATTGCGGAAGAAATTGAAAATTGCCGAAAGGGTAAAGAGTTTGGGTTCATTCCAGAC
ATGGCTCAATGGCGGATGCTTAGAGAGTTTTCCAAGAACAAGACCTTTGCGCTGGCGACTGTTTCTGCACACTTT
TCGCCCTCGTTTCTTGCCCTGGGGCAACGAGAGGACTTTGAAAAGCGATTGTCGGCGTTGGAGCAGTCATCTAAT
GGCCAAATGCAGATCGAGCTAGCCTCTGGAACCAGGATGAAGGATCCCGGAAACCTTCGAAACCTGGGCCGTTCG
CCTGGGACTCAAGGCTCACCTCGGGCCAAGGAAGATGAGAGGGTGATGCGTGAGGCGGCTGAAAGAAGACGGCAG
CGATTTGCTCAACATGCAGCTACTAGTATTCCTTGGACAAAGGACACAGTTTCGGATGGCAATGGCACGGCGTTT
GGAGAGAATAAATGA
Gene >OphauB2|184
ATGGGGGGCTCAGGGTGCCAAGACCCCTTTGAATGGGACGTTGGCGCTGTTGCAGATGCGCTCTGCTCTCTGGAA
CGACCGTGCGCTCAAGATCTCATTGCCTTTAGGGCAAAGCTCCATGAGCATGAAGTAGACGGCTTTACCCTGCTT
ACCTTTGAGTATGTATGCTCGAGGCCTGAGCTTTTTGAGACTTTGGGCATCAGGCTTGGCTGTTACAAGGCTGCG
CTGGGCTATGCCATCTTGCAACTGAGGGCCAAGAGCCCGCAGTTTCGACGGTGGAAGATTGCTGCTCTAAGCGAG
CTTGATGAGTCAAATGGCCCTCTTGTCGATGCCCCGCCCACCGACATGGTGAATGGGCTTGGGCAAAGAATGCCG
CCGGGCCCAGAGTCTGTAGGCGAGCAGCATCCTCTGCCGCGGAATAAACGCAAACATGAGGCCATGGAGACGGGT
TCCAAGACGCCAGGGGCTCAAGACCAGGATGCACTACAGAATAAACGGAGGCAGCGGGATACTGAGATGGGACAA
CATCGTTTCGACACTCCTACTCCTTCCGCGCCGGCCATGAGCCCTGTCCCAACTGTCCAAACCAGCCGCCACAAT
GCTCCCGCAGAAGCTGGGGGTTCCGTCTTGAGTCCTCAAACGAATCAAAATACTGAAAAGGGTTTGAAACGAAAA
AGAGTTGCGCCGCTTCAGCTCTCTGACTCTGTCGGACATCTTTCTAGCTTTGAGTCCGACTTTGAAGTGCCAGCA
CTCCGGCTAGAGGCCAATACTCCAAGAAGAAGCCTCTCTGATCAAGATGGAACTTTTCCCTGGGAAAAGCCCATG
CCATATAGTTACTTGGGGGCAGGCATCTTGTCAACATCTGCGGTCCGGTCTCCCCATGGCGCTCTCAACACCCAG
GTTTGCGAGAGAGCTGTTGGCGATGGCAACTTTTACATTAAATTCCCTTCTATATCTCCACCTGGCTTGCGGATA
GTAATTAATCGGGTGATGCAACGACACTTGATTAAAAATAGTAACCGCGAAGACTTGCTTCGCCAAGGCTTGGTG
CCCACGCGCACGAATACCCCGGATGAAGACGAATCAATCGACATATTCGACTTGCCGGATGAATGGGATGAGGAG
ACCCTCCGAGCTATAGAGCAAGACAGGATGGAAGAGCAAGAAGAAATGGAGGGATGCGTTCCCAAGGAGCGGGTG
CAAGCGTTGCTCCAAGAAGCCACCGACGCCTTCAAGACAACATGGGAAGAGACAAAACTACCCAAGCATCAACGC
AAGGCTTACAAGATGTGGACGAGCGCCCAGAGGCAGGGTACTCGAAGCCACCAAATCCTGACTGCGCGCTTTCGA
GCCAAAGAATGCGACAGGCGTCTCAAGAACCAGCAATCTGAGATTCTTGGACAGAGATGGGAAAGGGAAGCCGAG
GTTACCTGCCAAGCCATGATTATGGAGCAGAATCTCAGCGACAAGCTTTACCATCAATGGCTTGCCGAGATGCTG
GAGTCACGCACCGAGCCTCTCGGGCCTGCTAGTCTTCCAAAGCCCAAGGAACGACCCACGGTCCGCAGACCGGTG
CTCAAGGACACTGAAGTCTTGAGCAGCTCAGACGATGACGATTTCATTGTCGATGATGAGCCAGAGGAGCCAGTG
CAAGACGACGGTCCGTTGCATATGGACCATAACATGGAGGAGGACGTGGGCGGCCATGTGCATCCTGTTGAAGAT
GGTGGTGTTGCAAGTCGAGTCGAGATGATGGACCCAAGGGATGAGACCCCAGAATGGCCCGATTCACATAGTATT
GTGGATCTGACTGGTCTGGATAGTAGTCCAGAGCCGTCGCCGAGACGAGGCCGTGATTCACTGGTTATTGACTTG
ACGACTCCAAACAGATCTAGAGATGGGCGTCCGCCGCCATTGGAAACTCGTCTGAATACTCCAGATTTTGAACAG
GCTCCTCTACAAGAGCCGCAGGACGAGCCTCAGGGCGTGCCTCAAGAGATGCCTAATCAAGTTGCTCAAAAAGAA
GAGATTTCTCAAGAAGTGCCTCAAGAGGTGCTTAATAAAATTATTCAACAAGTATCTCAAGAGATTCTTCAAGAC
ACACCCCAAGAGGTGTCTGGAGAAGCGCCTGGGGACCCTCCTAAAAAGGCGCCTTCAAGCTTGTGGGATGTTGCC
GAGATTGGTCGCTATAGTCCGAAACATTGGGCCAAAGCCAAAGATGGCCCGCGGCTGGTCATATCACTACTCTGG
AGGATGGGCCATATACGCCGTGCTCCAATTTTCGATTCGGCCCGAGAAAGCTCTGCCGATGAACTATTTCTTACA
ACAATAGAGAGTCATCTCGCAGATCCTGTCACGGACAATTATGCATTGGCAGTGGACATGATTTGGATCTTCCTT
GCCTACATCAAGGCGCAAAACTGTGCACGCGAACGAATCCTCAACATATCCTCAAAGAGAGCCAAGCTTCTTCGT
CGCTCAGGTGAACAGTGGCAAGAGTTTTATGACTTTCTCAACGACATTGCCGTCGAATTCCCTCTAGACAGCCAA
ATCTTTCGGTCCGATAGTCTCGGCGAACTCGACGACTTTGATGATGAAATGGACGACGACGAAGCCCTTTCTGAC
AGCCAGGCTCACGGGACGCAAACTCGAAAGAATGCACCTAGAGAAATCGTACGTAATAGAGAAGCTTTGGATCTA
AGAGAGCGAGAGCGGCGTCGACTCGAGGAGCAGGAAGCCCGGCGAGCCAAGCTTAGAGCCACTCTGGATGCCCAT
GGTATCATGTCTCAAGATGAGTCCCGACTCATCATCAACGAAGCCAAGCAAGACGATCAGGCTTTTGTATACGTC
AACAGGGAAGCTGGAGAGCGTATCAAGGACCACCAGATTGACGGCGTGCGCTTCCTCTGGAACCAATCGATTCTT
GTTGACGCAAGCATGCGTCAAGGCTGTCTCCTTTCGCATACCATGGGCTTGGGCAAAACTATGCAAGTCATTACT
TTTCTTGTCGCAGTGCAAGAATGCGCACAGTCGTCAGACCCGGCTGTCCGTTCTCAGATAGCTGAAGACTTGAGA
TTGTCCAAGACATTGGTTATATGCCCCGCTGGGCTCGTGGACAATTGGTTGGATGAGTTCCTCATCTGGGTGCCC
GAAGCAAGTCAACTGCTTGGTCCCATTCGCAAGATTTCAGCAGATATGCGGCCTGAAGAGCGTCTTCAGATAATC
AATGCTTGGGCTGAAGAAGGAGGCGTCTTAATCATTGGCTACAACTTGTTCAAAAAGCTGGCAGCCGAGGATGGA
GATGTCGAGAAGCCTGTGTTGCTTAATACTCCCAACATTGTCATTGCCGATGAAGCTCATCTCCTCAAAAGCCCC
AAGACGGCAGTACACCAAGTTTCCTCGCGATTTCGGACTAACTGCCGCATCGCTCTGACTGGGTCGCCTTTGGCC
AACAATGTCAAGGAGTACTTCTCCATGATCAACTGGGTGGCCCCCATGTATCTGGGTGAATATAGCGAATTTCGG
GGAATTTACGAAAATCCTATTCACACTGGATTTTGGAGCGATAGCACCAGGGCACAAAAGAGAAAAGCACTCACC
ATGCTGCGCGTTCTCAGCGAGACAGTTGCACCAAAGGTTCACCGGAGGACCATTCAATGCCTCAGAAGCGACTTG
CCGCCCAAGCAAGAGTTCATCTTGTTTGTTCCACTGGGCGAATTGCAGTGCAGCCTCTACAACCTGTACATTGAG
GGTATCGACGCGGGAAAAACTCAGCACCTTACGGCTCTTGAAAACCTGAGGCTATTGTGTAACCATCCACGCTGC
TTTCGCGAAAAGGCTGCACAAGACCGGAAAACACGCCAGAATTTTCCAGAAGACGAAGCGTCGGCACAGAGTCTA
ATTCCAGAAAACATCATTTCCACCATTCTCAAGCTAACAAAGACGGCAGACATTGACAATGCAAACTTGTCCATC
AAGGCGCAGCTGCTGGTTATGATTCTGGACGAGGCTCGACTTGCACATGACAAGGTGCTCGTCTTTAGCCAGTCG
ATTCCGACATTGGATTACCTGTCAAATCTTTTGCATATGCAGCGGCGTCGGGTTTGCCGGTTGGATGGCTCAACG
ACAATTCGCAAGCGGCAAGAAATGGTCAAGAACTTCAACGAGGGCGATCAAGAAGTTTACTTGATCTCAACCACT
GCTGGCGGCGTCGGACTCAACATCCAAGGCGCCAATCGAGTCGTAATATACGACTTTGGATGGAATCCCGTCCAT
GATCAGCAAGCAGTTGGAAGAGCCTATCGTCTTGGACAGGAGAAGCCAGTTTTTGTATACCGATTTGTCGTTGTT
GGCACTTTTGAGGAGCACTTGAACAACAAGGCTGTTTACAAGATGCAGTTGGCTGCGCGAGTCGTTGACAAGAAG
AATCCAATAAGTTTTTCCAAGAAGCACTTAAGCGACTTGCTTCAAGTGCCCGTGCCAAAACCTGCCGAGCCGCTG
GATGAATTCGTCGGACGGGACCACATTCTCGACAAGCTCATCAAGTTCAAGAGTAATGGCGAGGCGATTCGATGG
ATAGTCTCGACGGATACGTTTGAAGAGGAGGACCCAACAGACAAGCTGACGGCTGAGGAGCGCCGAGACGCCGAG
GAGCTGGCAAAGCTGAATCGTTTGCGCTTGGTGGATCCGGCGGAATATGGAAGACGGCTCGAGGAGGACAGGGCA
AAGCAGCTGATGCTTCGCCTTTATAACGCTGTGGATGAGGCTATGCCCAACGATGGATTTGGGCAGACTGTTGCA
CCGGTTCAGCCCGTGCTTGCGGCAATGCCCCAAATGTCGAGAGTTGTGGTTCCAACTTATCATGCACCGCAGGAT
GCAGCTTTTCAAGACGGCCGGGCTCTAGGCTTTAATCCGCCTCAGTATCCAACTTTTAATCTGCCTCAGGATCCA
ACTTTTCATCAGCTTCAGGATGCAGCTTTTCATCAGCCACATGGCCCAGCTTTTCATCAGCCTCGTGGTCTAGCT
TTCCATCACGCTCGAGCTCCAGCTTTGCATCCACCTCAGGCCCCAATGGTGGCTCCAACGGAGACTGCTCCAACT
ATGCGAGCTCCTCTTGCAGATGCTTCGCTTGTTAGCCCTCTTGTGGCGACCACGGACGCAATGCCTGTTACAGAC
GCAAACGCGACCGAGATACCAGCGCCCGCAGAGCCAGGGCATGTGCCCGGTCCAGATTCAAGCATAATTCCAGCA
GCAGAAGCACCAGCGGTGCCGCAGCCGGATGAAGCGAATACAACGGCGCCTGTGACGGCAGTGGCAGTGGAAATA
GAGGATCCAAGGGATAAAGCGCAGAGCACATGCACGCCAGCAGTTGCTCCAGTGCCAGTCATGGGGACCAATACA
TACTTTGGTGAGAGAAATGAGGCTGAGCAAGAGCCATCAATTCCCAAGCCATCTACACCCATGCCATCAACTCCC
AAGCCATCACACTCTGTCATGTCAAATGGTTCGCCGGTAAAAAACCTCTTTTTCCCATGTCGCGATTCAGGAAGA
CGCCAGTTTGAAGAGATGCTGCTTGACAAGCTCAAGGAGCTCCAAGAGGACGGGGTTTCGGGCGTCGTGGGCGAC
AGAGACTGCATTGTCAAGATTGCGGAAGAAATTGAAAATTGCCGAAAGGGTAAAGAGTTTGGGTTCATTCCAGAC
ATGGCTCAATGGCGGATGCTTAGAGAGTTTTCCAAGAACAAGACCTTTGCGCTGGCGACTGTTTCTGCACACTTT
TCGCCCTCGTTTCTTGCCCTGGGGCAACGAGAGGACTTTGAAAAGCGATTGTCGGCGTTGGAGCAGTCATCTAAT
GGCCAAATGCAGATCGAGCTAGCCTCTGGAACCAGGATGAAGGATCCCGGAGTAAGAGCTTAGCGACTGTCCCAA
AAAAATAATAATACAAGGGACCAAAGGGAGCTAATAAAGTGGCAGAACCTTCGAAACCTGGGCCGTTCGCCTGGG
ACTCAAGGCTCACCTCGGGCCAAGGAAGATGAGAGGGTGATGCGTGAGGCGGCTGAAAGAAGACGGCAGCGATTT
GCTCAACATGCAGCTACTAGTATTCCTTGGACAAAGGACACAGTTTCGGATGGCAATGGCACGGCGTTTGGAGAG
AATAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail