Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1837
Gene name
LocationContig_151:40275..41077
Strand+
Gene length (bp)802
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25710|NUJM_NEUCR NADH-ubiquinone oxidoreductase 21.3 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B13D24.010 PE=4 SV=1 13 196 4.0E-51

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 53 75 22
3 87 104 17
4 108 130 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1837
MERQDEAMQQKPFKPHDVIDGMIKTGLFGLGGGLYIVAVRNALSKRNVGVLSIFTRGAPIIGICAAGPAAYAFFS
RTMMNLREKDDTWAAAFGGFMMGSVLGLPSRRMPVVVGLGALCSAIQGTIWFCGGRIDSFYNQEEDEFERKEKIR
RTTRVPVEQTIAEIGEGRGIRPPGYEERRRERILDKYGFEINPVKATVDGSS*
Coding >OphauB2|1837
ATGGAGCGTCAAGACGAAGCGATGCAGCAGAAGCCTTTCAAGCCCCACGACGTCATTGATGGAATGATCAAGACG
GGTCTTTTTGGCCTTGGCGGCGGTCTCTACATTGTTGCCGTTCGCAATGCTCTTTCAAAACGCAATGTTGGCGTC
TTGAGTATATTTACTCGGGGCGCACCCATCATTGGAATATGCGCTGCCGGACCTGCTGCCTATGCCTTTTTCTCT
CGCACCATGATGAACCTACGTGAGAAGGATGACACCTGGGCCGCTGCTTTTGGCGGCTTCATGATGGGCAGTGTT
CTCGGGTTGCCTTCCCGGCGAATGCCTGTCGTCGTTGGCCTCGGCGCCTTGTGCAGCGCCATCCAGGGCACTATA
TGGTTCTGTGGCGGCCGCATCGACAGCTTTTACAACCAAGAGGAAGACGAGTTTGAGCGCAAAGAAAAGATTCGG
CGAACAACCCGAGTACCTGTTGAGCAAACCATTGCCGAGATTGGCGAGGGGCGAGGTATTCGGCCCCCGGGCTAC
GAAGAGCGGAGGCGAGAAAGAATTTTGGACAAATACGGCTTTGAAATCAACCCCGTCAAGGCAACTGTCGATGGC
AGCAGCTAA
Transcript >OphauB2|1837
ATGGAGCGTCAAGACGAAGCGATGCAGCAGAAGCCTTTCAAGCCCCACGACGTCATTGATGGAATGATCAAGACG
GGTCTTTTTGGCCTTGGCGGCGGTCTCTACATTGTTGCCGTTCGCAATGCTCTTTCAAAACGCAATGTTGGCGTC
TTGAGTATATTTACTCGGGGCGCACCCATCATTGGAATATGCGCTGCCGGACCTGCTGCCTATGCCTTTTTCTCT
CGCACCATGATGAACCTACGTGAGAAGGATGACACCTGGGCCGCTGCTTTTGGCGGCTTCATGATGGGCAGTGTT
CTCGGGTTGCCTTCCCGGCGAATGCCTGTCGTCGTTGGCCTCGGCGCCTTGTGCAGCGCCATCCAGGGCACTATA
TGGTTCTGTGGCGGCCGCATCGACAGCTTTTACAACCAAGAGGAAGACGAGTTTGAGCGCAAAGAAAAGATTCGG
CGAACAACCCGAGTACCTGTTGAGCAAACCATTGCCGAGATTGGCGAGGGGCGAGGTATTCGGCCCCCGGGCTAC
GAAGAGCGGAGGCGAGAAAGAATTTTGGACAAATACGGCTTTGAAATCAACCCCGTCAAGGCAACTGTCGATGGC
AGCAGCTAA
Gene >OphauB2|1837
ATGGAGCGTCAAGACGAAGCGATGCAGCAGAAGCCTTTCAAGCCCCACGACGTCATTGATGGAATGATCAAGACG
GGTCTTTTTGGCCTTGGCGGCGGTCTCTACATTGTTGCCGTTCGCAATGCTCTTTCAAAACGCAATGTTGGCGTC
TTGAGTATATTTACTCGGGGCGCACCCATCATTGGAATATGCGGTACGCAAATTTGCTCGCAAGCAAATGCAGCA
GAGTCGCTGATGCTCCGGCTCCAGCTGCCGGACCTGCTGCCTATGCCTTTTTCTCTCGCACCATGATGAACCTAC
GTGAGAAGGATGACACCTGGGCCGCTGCTTTTGGCGGCTTCATGATGGGCAGTGTTCTCGGGTTGCCTTGTACGT
CTCAATCTTTGATACAACAATGGCATCGCTAGGACGTCTATTGACTCTCTTTTCGCTCACGGCGCAGCCCGGCGA
ATGCCTGTCGTCGTTGGCCTCGGCGCCTTGTGCAGCGCCATCCAGGGCACTATATGGTTCTGTGGCGGCCGCATC
GACAGCTTTTACAACCAAGAGGAAGACGAGTTTGAGCGCAAAGAAAAGATTCGGCGAACAACCCGAGTACCTGTT
GAGCAAACCATTGCCGAGATTGGCGAGGGGCGAGGTGAGTCAATCTCCTTTGCTTCTTGTTGTGGGTGCTTCCAG
TGCCCCGCTGATGACGGGTATAGGTATTCGGCCCCCGGGCTACGAAGAGCGGAGGCGAGAAAGAATTTTGGACAA
ATACGGCTTTGAAATCAACCCCGTCAAGGCAACTGTCGATGGCAGCAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail