Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1836
Gene name
LocationContig_151:38526..39705
Strand-
Gene length (bp)1179
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase 5.6E-19 250 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8X0|TRM10_GIBZE tRNA (guanine(9)-N1)-methyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TRM10 PE=3 SV=1 63 361 3.0E-118
sp|Q4WXA1|TRM10_ASPFU tRNA (guanine(9)-N1)-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=trm10 PE=3 SV=1 66 373 3.0E-80
sp|Q5B8X0|TRM10_EMENI tRNA (guanine(9)-N1)-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trm10 PE=3 SV=1 66 361 2.0E-74
sp|O14214|TRM10_SCHPO tRNA (guanine(9)-N1)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm10 PE=1 SV=1 66 366 1.0E-52
sp|Q59Q39|TRM10_CANAL tRNA (guanine(9)-N1)-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM10 PE=3 SV=1 66 368 2.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8X0|TRM10_GIBZE tRNA (guanine(9)-N1)-methyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TRM10 PE=3 SV=1 63 361 3.0E-118
sp|Q4WXA1|TRM10_ASPFU tRNA (guanine(9)-N1)-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=trm10 PE=3 SV=1 66 373 3.0E-80
sp|Q5B8X0|TRM10_EMENI tRNA (guanine(9)-N1)-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trm10 PE=3 SV=1 66 361 2.0E-74
sp|O14214|TRM10_SCHPO tRNA (guanine(9)-N1)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm10 PE=1 SV=1 66 366 1.0E-52
sp|Q59Q39|TRM10_CANAL tRNA (guanine(9)-N1)-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM10 PE=3 SV=1 66 368 2.0E-46
sp|Q6BWG3|TRM10_DEBHA tRNA (guanine(9)-N1)-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRM10 PE=3 SV=2 66 369 6.0E-46
sp|Q6C1W9|TRM10_YARLI tRNA (guanine(9)-N1)-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM10 PE=3 SV=1 39 357 9.0E-43
sp|Q6CUM6|TRM10_KLULA tRNA (guanine(9)-N1)-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRM10 PE=3 SV=1 66 357 1.0E-42
sp|Q6FQB2|TRM10_CANGA tRNA (guanine(9)-N1)-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRM10 PE=3 SV=1 76 357 8.0E-42
sp|Q12400|TRM10_YEAST tRNA (guanine(9)-N1)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM10 PE=1 SV=1 66 357 2.0E-41
sp|Q75A17|TRM10_ASHGO tRNA (guanine(9)-N1)-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRM10 PE=3 SV=1 89 374 3.0E-40
sp|Q8TBZ6|TM10A_HUMAN tRNA methyltransferase 10 homolog A OS=Homo sapiens GN=TRMT10A PE=1 SV=1 60 359 3.0E-37
sp|Q4KLI2|TM10A_RAT tRNA methyltransferase 10 homolog A OS=Rattus norvegicus GN=Trmt10a PE=1 SV=1 61 359 3.0E-34
sp|Q8C1Z8|TM10A_MOUSE tRNA methyltransferase 10 homolog A OS=Mus musculus GN=Trmt10a PE=2 SV=2 61 359 9.0E-33
sp|Q3MHI8|TM10A_BOVIN tRNA methyltransferase 10 homolog A OS=Bos taurus GN=TRMT10A PE=2 SV=1 263 359 2.0E-30
sp|P0CS10|TRM10_CRYNJ tRNA (guanine(9)-N1)-methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRM10 PE=3 SV=1 133 357 3.0E-29
sp|Q66JJ4|TM10A_XENTR tRNA methyltransferase 10 homolog A OS=Xenopus tropicalis GN=trmt10a PE=2 SV=1 263 359 8.0E-29
sp|P0CS11|TRM10_CRYNB tRNA (guanine(9)-N1)-methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRM10 PE=3 SV=1 133 357 1.0E-28
sp|Q9VR56|TM10A_DROME tRNA methyltransferase 10 homolog A OS=Drosophila melanogaster GN=trmt10a PE=2 SV=1 262 360 3.0E-22
sp|Q08BM0|TM10B_DANRE tRNA methyltransferase 10 homolog B OS=Danio rerio GN=trmt10b PE=2 SV=1 263 361 8.0E-18
sp|Q9D075|TM10B_MOUSE tRNA methyltransferase 10 homolog B OS=Mus musculus GN=Trmt10b PE=2 SV=2 264 361 1.0E-14
sp|Q08DP1|TM10B_BOVIN tRNA methyltransferase 10 homolog B OS=Bos taurus GN=TRMT10B PE=2 SV=1 26 361 3.0E-14
sp|Q5RJK3|TM10B_RAT tRNA methyltransferase 10 homolog B OS=Rattus norvegicus GN=Trmt10b PE=2 SV=1 264 361 1.0E-13
sp|Q6PF06|TM10B_HUMAN tRNA methyltransferase 10 homolog B OS=Homo sapiens GN=TRMT10B PE=2 SV=1 264 358 1.0E-13
sp|A4IHS0|MRRP1_XENTR Mitochondrial ribonuclease P protein 1 OS=Xenopus tropicalis GN=trmt10c PE=2 SV=1 264 357 4.0E-09
sp|Q3UFY8|MRRP1_MOUSE Mitochondrial ribonuclease P protein 1 OS=Mus musculus GN=Trmt10c PE=1 SV=2 264 370 1.0E-07
sp|Q3MHI8|TM10A_BOVIN tRNA methyltransferase 10 homolog A OS=Bos taurus GN=TRMT10A PE=2 SV=1 65 181 2.0E-07
sp|Q7JUX9|MRRP1_DROME Mitochondrial ribonuclease P protein 1 homolog OS=Drosophila melanogaster GN=trmt10c PE=1 SV=1 263 357 2.0E-07
sp|Q5U2R4|MRRP1_RAT Mitochondrial ribonuclease P protein 1 OS=Rattus norvegicus GN=Trmt10c PE=2 SV=1 264 357 5.0E-07
sp|Q7L0Y3|MRRP1_HUMAN Mitochondrial ribonuclease P protein 1 OS=Homo sapiens GN=TRMT10C PE=1 SV=2 264 370 1.0E-06
sp|Q2KI45|MRRP1_BOVIN Mitochondrial ribonuclease P protein 1 OS=Bos taurus GN=TRMT10C PE=2 SV=2 264 370 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1836
MTLHTESGHSVFSQDAPKGHDLQPSQSQAQTTSERDAATAEPQGDSCATQPQLMGICTQGAAALPLSKNALKRIR
RQQEWEEGRDDRRKRRKEKRQGRRQRLREERKSAVANGAHTAKISPTKVASTTVPMAVLVDCDFDAYMTDKEHTS
LAGQVTRCYSDNRNARYGAHLWIAGWTGKIRHRFQSVLGNQHQHWKGVGFVEGDFLACAEAARAQMRDSQGGPMI
KSLQRSLDHDASAACVKDDDSSRSQAEAQSQLNEAFSDVVYLTSESPYTLQRLEPHTCYVVGGLVDRNREKGLCY
RRARERGIRTAKLPIGQFMVMHSRQVLATNHVVEIMLKWLECGDWAEAFLAVIPKRKGGKLIGDESPSQESGDAG
IPMETWPKDGAQCNEDK*
Coding >OphauB2|1836
ATGACGCTGCATACAGAATCGGGCCATTCTGTGTTTTCACAAGATGCTCCAAAGGGCCACGACTTGCAGCCATCA
CAATCACAGGCACAGACGACAAGCGAGCGAGATGCTGCCACAGCCGAGCCTCAGGGAGACTCGTGTGCCACTCAA
CCGCAGCTTATGGGCATTTGTACACAAGGAGCGGCAGCATTGCCCTTATCCAAAAATGCACTCAAGCGCATCCGA
CGACAGCAGGAATGGGAGGAGGGCCGAGACGACCGGCGAAAACGGCGCAAGGAAAAGCGTCAAGGCCGCAGGCAG
CGTCTTCGCGAGGAGCGCAAGTCGGCTGTAGCCAATGGTGCCCATACAGCCAAGATATCCCCCACCAAGGTGGCC
TCGACCACCGTTCCCATGGCCGTACTTGTCGACTGTGATTTTGACGCCTACATGACGGACAAGGAGCACACTTCG
CTGGCCGGCCAGGTGACTCGGTGTTATTCTGATAATCGCAACGCCCGCTATGGCGCCCATCTCTGGATTGCGGGC
TGGACGGGCAAGATTCGACATCGCTTCCAAAGCGTGCTGGGCAACCAGCACCAGCACTGGAAGGGTGTGGGCTTT
GTCGAGGGCGACTTTTTGGCCTGTGCCGAGGCAGCCAGAGCGCAGATGCGCGACTCTCAAGGCGGACCGATGATT
AAATCTCTACAGCGCAGTCTTGACCACGACGCAAGCGCTGCATGCGTCAAGGACGACGACAGCTCTCGTTCCCAG
GCTGAGGCCCAGAGCCAGCTCAACGAGGCCTTTAGCGACGTTGTATATCTTACATCCGAGTCCCCATACACGCTG
CAGCGTCTTGAGCCGCACACATGCTACGTTGTCGGCGGACTCGTTGACCGCAACCGCGAAAAGGGGCTCTGCTAC
CGCCGCGCTCGTGAGCGTGGCATCCGCACGGCCAAACTGCCCATAGGCCAGTTCATGGTGATGCACAGTCGTCAA
GTATTGGCCACAAACCACGTTGTCGAAATCATGCTCAAGTGGCTCGAGTGCGGAGACTGGGCCGAGGCTTTCTTG
GCTGTGATACCAAAGCGCAAAGGCGGCAAGCTCATTGGCGACGAGAGCCCCAGCCAAGAATCTGGCGACGCCGGC
ATCCCGATGGAGACGTGGCCAAAAGACGGCGCGCAGTGCAACGAGGACAAATAG
Transcript >OphauB2|1836
ATGACGCTGCATACAGAATCGGGCCATTCTGTGTTTTCACAAGATGCTCCAAAGGGCCACGACTTGCAGCCATCA
CAATCACAGGCACAGACGACAAGCGAGCGAGATGCTGCCACAGCCGAGCCTCAGGGAGACTCGTGTGCCACTCAA
CCGCAGCTTATGGGCATTTGTACACAAGGAGCGGCAGCATTGCCCTTATCCAAAAATGCACTCAAGCGCATCCGA
CGACAGCAGGAATGGGAGGAGGGCCGAGACGACCGGCGAAAACGGCGCAAGGAAAAGCGTCAAGGCCGCAGGCAG
CGTCTTCGCGAGGAGCGCAAGTCGGCTGTAGCCAATGGTGCCCATACAGCCAAGATATCCCCCACCAAGGTGGCC
TCGACCACCGTTCCCATGGCCGTACTTGTCGACTGTGATTTTGACGCCTACATGACGGACAAGGAGCACACTTCG
CTGGCCGGCCAGGTGACTCGGTGTTATTCTGATAATCGCAACGCCCGCTATGGCGCCCATCTCTGGATTGCGGGC
TGGACGGGCAAGATTCGACATCGCTTCCAAAGCGTGCTGGGCAACCAGCACCAGCACTGGAAGGGTGTGGGCTTT
GTCGAGGGCGACTTTTTGGCCTGTGCCGAGGCAGCCAGAGCGCAGATGCGCGACTCTCAAGGCGGACCGATGATT
AAATCTCTACAGCGCAGTCTTGACCACGACGCAAGCGCTGCATGCGTCAAGGACGACGACAGCTCTCGTTCCCAG
GCTGAGGCCCAGAGCCAGCTCAACGAGGCCTTTAGCGACGTTGTATATCTTACATCCGAGTCCCCATACACGCTG
CAGCGTCTTGAGCCGCACACATGCTACGTTGTCGGCGGACTCGTTGACCGCAACCGCGAAAAGGGGCTCTGCTAC
CGCCGCGCTCGTGAGCGTGGCATCCGCACGGCCAAACTGCCCATAGGCCAGTTCATGGTGATGCACAGTCGTCAA
GTATTGGCCACAAACCACGTTGTCGAAATCATGCTCAAGTGGCTCGAGTGCGGAGACTGGGCCGAGGCTTTCTTG
GCTGTGATACCAAAGCGCAAAGGCGGCAAGCTCATTGGCGACGAGAGCCCCAGCCAAGAATCTGGCGACGCCGGC
ATCCCGATGGAGACGTGGCCAAAAGACGGCGCGCAGTGCAACGAGGACAAATAG
Gene >OphauB2|1836
ATGACGCTGCATACAGAATCGGGCCATTCTGTGTTTTCACAAGATGCTCCAAAGGGCCACGACTTGCAGCCATCA
CAATCACAGGCACAGACGACAAGCGAGCGAGATGCTGCCACAGCCGAGCCTCAGGGAGACTCGTGTGCCACTCAA
CCGCAGCTTATGGGCATTTGTACACAAGGAGCGGCAGCATTGCCCTTATCCAAAAATGCACTCAAGCGCATCCGA
CGACAGCAGGAATGGGAGGAGGGCCGAGACGACCGGCGAAAACGGCGCAAGGAAAAGCGTCAAGGCCGCAGGCAG
CGTCTTCGCGAGGAGCGCAAGTCGGCTGTAGCCAATGGTGCCCATACAGCCAAGATATCCCCCACCAAGGTGGCC
TCGACCACCGTTCCCATGGCCGTACTTGTCGACTGTGATTTTGACGCCTACATGACGGACAAGGAGCACACTTCG
CTGGCCGGCCAGGTGACTCGGTGTTATTCTGATAATCGCAACGCCCGCTATGGCGCCCATCTCTGGATTGCGGGC
TGGACGGGCAAGATTCGACATCGCTTCCAAAGCGTGCTGGGCAACCAGCACCAGCACTGGAAGGGTGTGGGCTTT
GTCGAGGGCGACTTTTTGGCCTGTGCCGAGGCAGCCAGAGCGCAGATGCGCGACTCTCAAGGCGGACCGATGATT
AAATCTCTACAGCGCAGTCTTGACCACGACGCAAGCGCTGCATGCGTCAAGGACGACGACAGCTCTCGTTCCCAG
GCTGAGGCCCAGAGCCAGCTCAACGAGGCCTTTAGCGACGTTGTATATCTTACATCCGAGTCCCCATACACGCTG
CAGCGTCTTGAGCCGCACACATGCTACGTTGTCGGCGGACTCGTTGACCGCAACCGCGAAAAGGGGCTCTGCTAC
CGCCGCGCTCGTGAGCGTGGCATCCGCACGGCCAAACTGCCCATAGGCCAGTTCATGGTGATGCACAGTCGTCAA
GTATTGGCCACAAACCACGTTGTCGAAATCATGCTCAAGTGGCTCGAGTGCGGAGACTGGGCCGAGGCTTTCTTG
GCTGTGATACCAAAGCGCAAAGGCGGCAAGCTCATTGGCGACGAGAGCCCCAGCCAAGAATCTGGCGACGCCGGC
ATCCCGATGGAGACGTGGCCAAAAGACGGCGCGCAGTGCAACGAGGACAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail