Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1835
Gene name
LocationContig_151:36669..38438
Strand+
Gene length (bp)1769
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01896 DNA_primase_S DNA primase small subunit 1.4E-64 212 442

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14215|PRI1_SCHPO DNA primase small subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pri1 PE=1 SV=1 110 520 6.0E-163
sp|P20664|PRI1_MOUSE DNA primase small subunit OS=Mus musculus GN=Prim1 PE=1 SV=1 110 519 1.0E-116
sp|P49642|PRI1_HUMAN DNA primase small subunit OS=Homo sapiens GN=PRIM1 PE=1 SV=1 113 519 8.0E-114
sp|P10363|PRI1_YEAST DNA primase small subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRI1 PE=1 SV=2 116 525 2.0E-111
sp|Q24317|PRI1_DROME DNA primase small subunit OS=Drosophila melanogaster GN=DNApol-alpha50 PE=2 SV=2 108 525 8.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14215|PRI1_SCHPO DNA primase small subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pri1 PE=1 SV=1 110 520 6.0E-163
sp|P20664|PRI1_MOUSE DNA primase small subunit OS=Mus musculus GN=Prim1 PE=1 SV=1 110 519 1.0E-116
sp|P49642|PRI1_HUMAN DNA primase small subunit OS=Homo sapiens GN=PRIM1 PE=1 SV=1 113 519 8.0E-114
sp|P10363|PRI1_YEAST DNA primase small subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRI1 PE=1 SV=2 116 525 2.0E-111
sp|Q24317|PRI1_DROME DNA primase small subunit OS=Drosophila melanogaster GN=DNApol-alpha50 PE=2 SV=2 108 525 8.0E-95
sp|Q25998|PRI1_PLAFK DNA primase small subunit OS=Plasmodium falciparum (isolate K1 / Thailand) PE=3 SV=1 119 506 3.0E-78
sp|Q7KQM1|PRI1_PLAF7 DNA primase small subunit OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0366 PE=3 SV=1 119 506 3.0E-78
sp|P34471|PRI1_CAEEL DNA primase small subunit OS=Caenorhabditis elegans GN=pri-1 PE=3 SV=1 113 506 5.0E-63
sp|Q5V554|PRIS_HALMA DNA primase small subunit PriS OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=priS PE=3 SV=1 207 456 2.0E-07
sp|A3MUU9|PRIS_PYRCJ DNA primase small subunit PriS OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=priS PE=3 SV=1 132 296 6.0E-07
sp|A1RRN3|PRIS_PYRIL DNA primase small subunit PriS OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=priS PE=3 SV=1 132 296 8.0E-07
sp|O29516|PRIS_ARCFU DNA primase small subunit PriS OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=priS PE=3 SV=2 143 293 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006269 DNA replication, synthesis of RNA primer Yes
GO:0003896 DNA primase activity Yes
GO:0003674 molecular_function No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0097747 RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0003899 DNA-directed 5'-3' RNA polymerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0019438 aromatic compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0016070 RNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0090304 nucleic acid metabolic process No
GO:0003824 catalytic activity No
GO:0044271 cellular nitrogen compound biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5145
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7804
Ophiocordyceps australis map64 (Brazil) OphauB2|1835 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3209
Ophiocordyceps kimflemingae Ophio5|411
Ophiocordyceps subramaniannii Hirsu2|3552

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1835
MPHSIKTEAMSSPAASKEELPQESRSEPHQESDAQEEPLEDKAEEQDDDGTKADIPLGERKLETTGKTTELDELF
DNEGSDEEFPTSARAGESSSPDRGALPLAVVDLEASDPEVMRSFYQRLFPWRHVFQWLNHGPTPTSDFGNREFAF
TLQNDAYLRYQSFATADLLRKDVLRLLPSRFEIGPVYTTNPRDRKTLRNSSAFKPLAKELCFDIDLTDYDDVRTC
CDKANICSKCWAFMTMAIRVVDVALRDDFGFKHILWVYSGRRGAHAWVCDKSARSLDDQRRRAIAGYLDVVRGGA
QNSKKVNIRRPLHPHVARSLDILKTHFQEHVLQAQDPWASNEQADKLLQLLPDHTLNESLRRKWDAAPGRASTSK
WADIDAMAKTGASKKLDSKALLEANQDIVLEYTYPRLDIEVSKKLNHLLKSPFVVHPGTGRVCVPIDTKSLADFD
PLNVPTVQGLLAEIDAWRHQDNDSGHEENGKGLSDWEKTSLKPYVDYFRSFIAGVIKDERDGRTKRERDEASMHF
*
Coding >OphauB2|1835
ATGCCACACTCGATCAAAACAGAAGCCATGTCGTCGCCGGCCGCAAGCAAAGAAGAGTTGCCTCAAGAGTCGCGC
TCTGAGCCGCACCAAGAGTCTGACGCTCAGGAGGAACCTTTGGAGGACAAAGCGGAAGAACAAGACGACGATGGG
ACCAAAGCCGATATTCCCCTGGGAGAGAGAAAACTAGAGACGACGGGGAAGACGACTGAGCTGGATGAACTGTTT
GATAATGAGGGATCTGATGAAGAATTTCCCACTTCAGCACGCGCGGGGGAATCGAGTTCCCCGGACAGAGGCGCG
TTGCCCCTCGCCGTTGTGGACTTGGAGGCGTCGGATCCCGAGGTGATGCGCAGCTTCTACCAGCGTCTGTTTCCG
TGGAGACATGTCTTCCAGTGGCTCAACCATGGGCCGACGCCTACAAGCGACTTTGGCAACCGCGAGTTTGCATTC
ACGCTGCAAAACGACGCCTACTTGCGCTACCAGTCTTTTGCCACGGCCGATCTGCTCCGCAAAGATGTGCTCCGT
CTGCTTCCTTCGCGGTTCGAAATCGGTCCCGTCTACACAACGAATCCTCGCGACCGCAAGACGCTGCGCAACTCA
TCGGCCTTTAAGCCCCTGGCCAAAGAGCTCTGTTTCGACATTGATCTGACAGACTACGACGATGTGCGCACCTGC
TGCGACAAGGCAAATATCTGTAGCAAATGCTGGGCCTTTATGACAATGGCCATCCGGGTCGTCGATGTGGCCCTG
CGAGACGACTTTGGCTTCAAGCACATCCTGTGGGTTTATTCAGGTCGCAGAGGAGCCCACGCCTGGGTCTGCGAC
AAAAGTGCGCGCAGTCTGGACGACCAGAGGAGACGGGCCATAGCGGGATACCTGGACGTGGTTCGGGGCGGGGCG
CAAAACAGCAAAAAGGTCAATATACGGCGGCCGTTGCACCCCCATGTTGCACGAAGTCTGGACATTCTCAAGACG
CACTTTCAAGAGCATGTGCTCCAAGCCCAGGATCCCTGGGCTTCCAACGAGCAGGCCGACAAGCTGCTGCAGCTG
CTCCCAGACCACACGCTCAACGAGTCGCTGCGGCGCAAGTGGGATGCGGCTCCGGGTCGCGCCTCAACATCAAAG
TGGGCTGATATTGATGCCATGGCCAAGACGGGTGCCAGCAAGAAGCTCGACTCCAAGGCCCTGTTGGAAGCCAAT
CAAGACATTGTTCTCGAATACACATACCCGCGTCTCGACATTGAGGTCAGCAAGAAGCTCAATCATTTGCTCAAG
AGCCCCTTTGTCGTCCATCCCGGTACCGGCCGCGTGTGTGTGCCCATAGACACCAAGAGCCTTGCAGACTTTGAT
CCGCTCAACGTGCCCACCGTCCAGGGGCTGCTCGCAGAGATTGATGCCTGGCGCCACCAAGACAACGACTCGGGC
CACGAGGAAAATGGCAAAGGCCTGTCAGACTGGGAGAAGACGAGCCTGAAGCCCTATGTCGACTACTTTCGGTCT
TTTATTGCCGGTGTCATCAAGGATGAGAGAGACGGTCGTACCAAGAGGGAACGAGATGAGGCTAGCATGCATTTT
TAA
Transcript >OphauB2|1835
ATGCCACACTCGATCAAAACAGAAGCCATGTCGTCGCCGGCCGCAAGCAAAGAAGAGTTGCCTCAAGAGTCGCGC
TCTGAGCCGCACCAAGAGTCTGACGCTCAGGAGGAACCTTTGGAGGACAAAGCGGAAGAACAAGACGACGATGGG
ACCAAAGCCGATATTCCCCTGGGAGAGAGAAAACTAGAGACGACGGGGAAGACGACTGAGCTGGATGAACTGTTT
GATAATGAGGGATCTGATGAAGAATTTCCCACTTCAGCACGCGCGGGGGAATCGAGTTCCCCGGACAGAGGCGCG
TTGCCCCTCGCCGTTGTGGACTTGGAGGCGTCGGATCCCGAGGTGATGCGCAGCTTCTACCAGCGTCTGTTTCCG
TGGAGACATGTCTTCCAGTGGCTCAACCATGGGCCGACGCCTACAAGCGACTTTGGCAACCGCGAGTTTGCATTC
ACGCTGCAAAACGACGCCTACTTGCGCTACCAGTCTTTTGCCACGGCCGATCTGCTCCGCAAAGATGTGCTCCGT
CTGCTTCCTTCGCGGTTCGAAATCGGTCCCGTCTACACAACGAATCCTCGCGACCGCAAGACGCTGCGCAACTCA
TCGGCCTTTAAGCCCCTGGCCAAAGAGCTCTGTTTCGACATTGATCTGACAGACTACGACGATGTGCGCACCTGC
TGCGACAAGGCAAATATCTGTAGCAAATGCTGGGCCTTTATGACAATGGCCATCCGGGTCGTCGATGTGGCCCTG
CGAGACGACTTTGGCTTCAAGCACATCCTGTGGGTTTATTCAGGTCGCAGAGGAGCCCACGCCTGGGTCTGCGAC
AAAAGTGCGCGCAGTCTGGACGACCAGAGGAGACGGGCCATAGCGGGATACCTGGACGTGGTTCGGGGCGGGGCG
CAAAACAGCAAAAAGGTCAATATACGGCGGCCGTTGCACCCCCATGTTGCACGAAGTCTGGACATTCTCAAGACG
CACTTTCAAGAGCATGTGCTCCAAGCCCAGGATCCCTGGGCTTCCAACGAGCAGGCCGACAAGCTGCTGCAGCTG
CTCCCAGACCACACGCTCAACGAGTCGCTGCGGCGCAAGTGGGATGCGGCTCCGGGTCGCGCCTCAACATCAAAG
TGGGCTGATATTGATGCCATGGCCAAGACGGGTGCCAGCAAGAAGCTCGACTCCAAGGCCCTGTTGGAAGCCAAT
CAAGACATTGTTCTCGAATACACATACCCGCGTCTCGACATTGAGGTCAGCAAGAAGCTCAATCATTTGCTCAAG
AGCCCCTTTGTCGTCCATCCCGGTACCGGCCGCGTGTGTGTGCCCATAGACACCAAGAGCCTTGCAGACTTTGAT
CCGCTCAACGTGCCCACCGTCCAGGGGCTGCTCGCAGAGATTGATGCCTGGCGCCACCAAGACAACGACTCGGGC
CACGAGGAAAATGGCAAAGGCCTGTCAGACTGGGAGAAGACGAGCCTGAAGCCCTATGTCGACTACTTTCGGTCT
TTTATTGCCGGTGTCATCAAGGATGAGAGAGACGGTCGTACCAAGAGGGAACGAGATGAGGCTAGCATGCATTTT
TAA
Gene >OphauB2|1835
ATGCCACACTCGATCAAAACAGAAGCCATGTCGTCGCCGGCCGCAAGCAAAGAAGAGTTGCCTCAAGAGTCGCGC
TCTGAGCCGCACCAAGAGTCTGACGCTCAGGAGGAACCTTTGGAGGACAAAGCGGAAGAACAAGACGACGATGGG
ACCAAAGCCGATATTCCCCTGGGAGAGAGAAAACTAGAGACGACGGGGAAGACGACTGAGCTGGATGAACTGTTT
GATAATGAGGGATCTGATGAAGAATTTCCCACTTCAGCACGCGCGGGGGAATCGAGTTCCCCGGACAGAGGCGCG
TTGCCCCTGTAGGTGCTGCTGCTGAGCGAAGCGCAAGTCTGGCGCTGATGTGCAAGATTACAGCGCCGTTGTGGA
CTTGGAGGCGTCGGATCCCGAGGTGATGCGCAGCTTCTACCAGCGTCTGTTTCCGTGGAGACATGTCTTCCAGTG
GCTCAACCATGGGCCGACGCCTACAAGCGACTTTGGCAACCGCGAGTTTGCATTCACGCTGCAAAACGACGCCTA
CTTGCGCTACCAGTCTTTTGCCACGGCCGATCTGTAGGTGCAACAAGACGTGAGGCAAGACAACGTGTCGCTTAC
ACAGTGGTGCTTCAACACGCAGGCTCCGCAAAGATGTGCTCCGTCTGCTTCCTTCGCGGTTCGAAATCGGTCCCG
TCTACACAACGAATCCTCGCGACCGCAAGACGCTGCGCAACTCATCGGCCTTTAAGCCCCTGGCCAAAGAGCTCT
GTTTCGACATTGATCTGACAGACTACGACGATGTGCGCACCTGCTGCGACAAGGCAAATATCTGTAGCAAATGCT
GGGCCTTTATGACAATGGCCATCCGGGTCGTCGATGTGGCCCTGCGAGACGACTTTGGCTTCAAGCACATCCTGT
GGGTTTATTCAGGTCGCAGAGGAGCCCACGCCTGGGTCTGCGACAAAAGTGCGCGCAGTCTGGACGACCAGAGGA
GACGGGCCATAGCGGGATACCTGGACGTGGTTCGGGGCGGGGCGCAAAACAGCAAAAAGGTCAATATACGGCGGC
CGTTGCACCCCCATGTTGCGTATGTCCTTGCTGCCTTGAAATGGATCCCGCCATGAGAGCACAGTGCTGACGTTG
GGAGCGTGCACCACAGACGAAGTCTGGACATTCTCAAGACGCACTTTCAAGAGCATGTGCTCCAAGCCCAGGATC
CCTGGGCTTCCAACGAGCAGGCCGACAAGCTGCTGCAGCTGCTCCCAGACCACACGCTCAACGAGTCGCTGCGGC
GCAAGTGGGATGCGGCTCCGGGTCGCGCCTCAACATCAAAGTGGGCTGATATTGATGCCATGGCCAAGACGGGTG
CCAGCAAGAAGCTCGACTCCAAGGCCCTGTTGGAAGCCAATCAAGACATTGTTCTCGAATACACATACCCGCGTC
TCGACATTGAGGTCAGCAAGAAGCTCAATCATTTGCTCAAGAGCCCCTTTGTCGTCCATCCCGGTACCGGCCGCG
TGTGTGTGCCCATAGACACCAAGAGCCTTGCAGACTTTGATCCGCTCAACGTGCCCACCGTCCAGGGGCTGCTCG
CAGAGATTGATGCCTGGCGCCACCAAGACAACGACTCGGGCCACGAGGAAAATGGCAAAGGCCTGTCAGACTGGG
AGAAGACGAGCCTGAAGCCCTATGTCGACTACTTTCGGTCTTTTATTGCCGGTGTCATCAAGGATGAGAGAGACG
GTCGTACCAAGAGGGAACGAGATGAGGCTAGCATGCATTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail