Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1834
Gene name
LocationContig_151:33649..35747
Strand+
Gene length (bp)2098
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00447 HSF_DNA-bind HSF-type DNA-binding 5.6E-30 19 119
PF00072 Response_reg Response regulator receiver domain 1.4E-23 352 464

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14283|PRR1_SCHPO Transcription factor prr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prr1 PE=1 SV=2 13 455 1.0E-57
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 16 214 2.0E-35
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 16 125 2.0E-31
sp|P38531|HSF3_CHICK Heat shock factor protein 3 OS=Gallus gallus GN=HSF3 PE=2 SV=1 19 212 6.0E-28
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 196 460 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14283|PRR1_SCHPO Transcription factor prr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prr1 PE=1 SV=2 13 455 1.0E-57
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 16 214 2.0E-35
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 16 125 2.0E-31
sp|P38531|HSF3_CHICK Heat shock factor protein 3 OS=Gallus gallus GN=HSF3 PE=2 SV=1 19 212 6.0E-28
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 196 460 2.0E-23
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 352 460 2.0E-22
sp|Q5AQ33|HSF_CANAL Heat shock transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTA8 PE=1 SV=1 19 221 8.0E-22
sp|Q9R0L1|HSF4_MOUSE Heat shock factor protein 4 OS=Mus musculus GN=Hsf4 PE=1 SV=2 19 194 4.0E-21
sp|Q02953|HSF_SCHPO Heat shock factor protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsf1 PE=1 SV=2 17 203 4.0E-21
sp|Q1HGE8|HSF4_CANLF Heat shock factor protein 4 OS=Canis lupus familiaris GN=HSF4 PE=2 SV=1 19 194 1.0E-20
sp|P38533|HSF2_MOUSE Heat shock factor protein 2 OS=Mus musculus GN=Hsf2 PE=2 SV=2 13 214 1.0E-20
sp|Q9ULV5|HSF4_HUMAN Heat shock factor protein 4 OS=Homo sapiens GN=HSF4 PE=1 SV=2 19 194 2.0E-20
sp|Q03933|HSF2_HUMAN Heat shock factor protein 2 OS=Homo sapiens GN=HSF2 PE=1 SV=1 13 214 2.0E-20
sp|P41154|HSF_XENLA Heat shock factor protein OS=Xenopus laevis GN=hsf1 PE=2 SV=1 13 194 5.0E-20
sp|D0VYS2|HSF3_MOUSE Heat shock factor protein 3 OS=Mus musculus GN=Hsf3 PE=2 SV=1 19 194 7.0E-20
sp|P22813|HSF_DROME Heat shock factor protein OS=Drosophila melanogaster GN=Hsf PE=1 SV=1 9 229 1.0E-19
sp|P38529|HSF1_CHICK Heat shock factor protein 1 OS=Gallus gallus GN=HSF1 PE=2 SV=1 14 194 2.0E-19
sp|P38530|HSF2_CHICK Heat shock factor protein 2 OS=Gallus gallus GN=HSF2 PE=2 SV=1 19 214 4.0E-19
sp|Q08DJ8|HSF1_BOVIN Heat shock factor protein 1 OS=Bos taurus GN=HSF1 PE=2 SV=1 14 194 6.0E-19
sp|Q00613|HSF1_HUMAN Heat shock factor protein 1 OS=Homo sapiens GN=HSF1 PE=1 SV=1 14 194 5.0E-18
sp|P38532|HSF1_MOUSE Heat shock factor protein 1 OS=Mus musculus GN=Hsf1 PE=1 SV=2 14 194 7.0E-18
sp|Q84T61|HSFA1_ORYSJ Heat stress transcription factor A-1 OS=Oryza sativa subsp. japonica GN=HSFA1 PE=2 SV=1 7 194 3.0E-17
sp|Q8GYY1|HSFA3_ARATH Heat stress transcription factor A-3 OS=Arabidopsis thaliana GN=HSFA3 PE=2 SV=2 13 194 4.0E-17
sp|Q942D6|HFC1B_ORYSJ Heat stress transcription factor C-1b OS=Oryza sativa subsp. japonica GN=HSFC1B PE=2 SV=1 7 199 5.0E-17
sp|P22121|HSF_KLULA Heat shock factor protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSF PE=1 SV=1 19 194 5.0E-17
sp|Q0DBL6|HFC2B_ORYSJ Heat stress transcription factor C-2b OS=Oryza sativa subsp. japonica GN=HSFC2B PE=3 SV=1 19 194 1.0E-16
sp|O80982|HSFA2_ARATH Heat stress transcription factor A-2 OS=Arabidopsis thaliana GN=HSFA2 PE=1 SV=1 19 119 1.0E-16
sp|Q9SV12|HFA7A_ARATH Heat stress transcription factor A-7a OS=Arabidopsis thaliana GN=HSFA7A PE=2 SV=1 19 121 5.0E-16
sp|Q652B0|HFB2C_ORYSJ Heat stress transcription factor B-2c OS=Oryza sativa subsp. japonica GN=HSFB2C PE=2 SV=1 19 119 7.0E-16
sp|Q96320|HSFB1_ARATH Heat stress transcription factor B-1 OS=Arabidopsis thaliana GN=HSFB1 PE=2 SV=2 19 119 9.0E-16
sp|Q9SCW4|HFB2A_ARATH Heat stress transcription factor B-2a OS=Arabidopsis thaliana GN=HSFB2A PE=2 SV=1 19 119 9.0E-16
sp|P10961|HSF_YEAST Heat shock factor protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSF1 PE=1 SV=1 19 119 1.0E-15
sp|P22335|HSF24_SOLPE Heat shock factor protein HSF24 OS=Solanum peruvianum GN=HSF24 PE=2 SV=1 19 126 2.0E-15
sp|Q9C635|HSFB4_ARATH Heat stress transcription factor B-4 OS=Arabidopsis thaliana GN=HSFB4 PE=2 SV=1 6 137 4.0E-15
sp|Q7XRX3|HFB2A_ORYSJ Heat stress transcription factor B-2a OS=Oryza sativa subsp. japonica GN=HSFB2A PE=2 SV=2 19 119 4.0E-15
sp|Q6Z9C8|HFB2B_ORYSJ Heat stress transcription factor B-2b OS=Oryza sativa subsp. japonica GN=HSFB2B PE=2 SV=1 19 119 4.0E-15
sp|Q6EUG4|HFC2A_ORYSJ Heat stress transcription factor C-2a OS=Oryza sativa subsp. japonica GN=HSFC2A PE=2 SV=1 19 84 5.0E-15
sp|Q9SCW5|HFA1E_ARATH Heat stress transcription factor A-1e OS=Arabidopsis thaliana GN=HSFA1E PE=2 SV=2 19 194 6.0E-15
sp|Q6H6Q7|HSFA3_ORYSJ Heat stress transcription factor A-3 OS=Oryza sativa subsp. japonica GN=HSFA3 PE=2 SV=1 19 194 7.0E-15
sp|Q9T0D3|HFB2B_ARATH Heat stress transcription factor B-2b OS=Arabidopsis thaliana GN=HSFB2B PE=2 SV=1 19 119 8.0E-15
sp|Q94J16|HFA4B_ORYSJ Heat stress transcription factor A-4b OS=Oryza sativa subsp. japonica GN=HSFA4B PE=2 SV=1 19 121 9.0E-15
sp|O81821|HFA1B_ARATH Heat stress transcription factor A-1b OS=Arabidopsis thaliana GN=HSFA1B PE=2 SV=2 14 122 1.0E-14
sp|Q9LV52|HSFC1_ARATH Heat stress transcription factor C-1 OS=Arabidopsis thaliana GN=HSFC1 PE=2 SV=1 19 155 1.0E-14
sp|Q94BZ5|HSFA5_ARATH Heat stress transcription factor A-5 OS=Arabidopsis thaliana GN=HSFA5 PE=2 SV=1 19 194 1.0E-14
sp|Q67TP9|HSFB1_ORYSJ Heat stress transcription factor B-1 OS=Oryza sativa subsp. japonica GN=HSFB1 PE=2 SV=1 19 129 1.0E-14
sp|Q93VB5|HFA4D_ORYSJ Heat stress transcription factor A-4d OS=Oryza sativa subsp. japonica GN=HSFA4D PE=1 SV=1 19 122 1.0E-14
sp|P41152|HSF30_SOLPE Heat shock factor protein HSF30 OS=Solanum peruvianum GN=HSF30 PE=2 SV=1 19 194 2.0E-14
sp|Q10KX8|HFB4D_ORYSJ Heat stress transcription factor B-4d OS=Oryza sativa subsp. japonica GN=HSFB4D PE=3 SV=1 19 119 2.0E-14
sp|Q6K6S5|HSFA5_ORYSJ Heat stress transcription factor A-5 OS=Oryza sativa subsp. japonica GN=HSFA5 PE=2 SV=1 19 194 3.0E-14
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 352 470 3.0E-14
sp|Q84MN7|HFA2A_ORYSJ Heat stress transcription factor A-2a OS=Oryza sativa subsp. japonica GN=HSFA2A PE=2 SV=1 19 119 8.0E-14
sp|Q5A287|SFL1_CANAL Transcription factor SFL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFL1 PE=1 SV=1 19 120 9.0E-14
sp|Q40152|HSF8_SOLLC Heat shock factor protein HSF8 OS=Solanum lycopersicum GN=HSF8 PE=3 SV=1 19 122 9.0E-14
sp|Q9S7U5|HSFA8_ARATH Heat stress transcription factor A-8 OS=Arabidopsis thaliana GN=HSFA8 PE=2 SV=1 19 194 1.0E-13
sp|O22230|HSFB3_ARATH Heat stress transcription factor B-3 OS=Arabidopsis thaliana GN=HSFB3 PE=2 SV=1 19 119 1.0E-13
sp|Q6Z9R8|HFB4A_ORYSJ Putative heat stress transcription factor B-4a OS=Oryza sativa subsp. japonica GN=HSFB4A PE=3 SV=1 19 122 2.0E-13
sp|Q9M1V5|HFA7B_ARATH Heat stress transcription factor A-7b OS=Arabidopsis thaliana GN=HSFA7B PE=2 SV=1 17 120 2.0E-13
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 341 465 2.0E-13
sp|P41153|HSF8_SOLPE Heat shock factor protein HSF8 OS=Solanum peruvianum GN=HSF8 PE=2 SV=1 19 121 3.0E-13
sp|Q7XHZ0|HFB4B_ORYSJ Heat stress transcription factor B-4b OS=Oryza sativa subsp. japonica GN=HSFB4B PE=1 SV=1 19 119 3.0E-13
sp|Q67U94|HFB4C_ORYSJ Heat stress transcription factor B-4c OS=Oryza sativa subsp. japonica GN=HSFB4C PE=3 SV=1 19 119 3.0E-13
sp|Q6VBA4|HFC1A_ORYSJ Heat stress transcription factor C-1a OS=Oryza sativa subsp. japonica GN=HSFC1A PE=2 SV=2 19 119 4.0E-13
sp|Q9LQM7|HFA1D_ARATH Heat stress transcription factor A-1d OS=Arabidopsis thaliana GN=HSFA1D PE=1 SV=2 19 194 7.0E-13
sp|P41151|HFA1A_ARATH Heat stress transcription factor A-1a OS=Arabidopsis thaliana GN=HSFA1A PE=1 SV=2 19 84 8.0E-13
sp|Q338B0|HFA2C_ORYSJ Heat stress transcription factor A-2c OS=Oryza sativa subsp. japonica GN=HSFA2C PE=1 SV=2 19 135 1.0E-12
sp|Q10PR4|HSFA9_ORYSJ Heat stress transcription factor A-9 OS=Oryza sativa subsp. japonica GN=HSFA9 PE=2 SV=1 19 191 1.0E-12
sp|Q657C0|HFA6B_ORYSJ Heat stress transcription factor A-6a OS=Oryza sativa subsp. japonica GN=HSFA6B PE=2 SV=1 19 206 1.0E-12
sp|Q1PDN3|HFA6A_ARATH Heat stress transcription factor A-6a OS=Arabidopsis thaliana GN=HSFA6A PE=2 SV=1 19 130 2.0E-12
sp|Q9LUH8|HFA6B_ARATH Heat stress transcription factor A-6b OS=Arabidopsis thaliana GN=HSFA6b PE=2 SV=1 19 122 3.0E-12
sp|Q9LVW2|HSFA9_ARATH Heat stress transcription factor A-9 OS=Arabidopsis thaliana GN=HSFA9 PE=2 SV=1 19 201 4.0E-12
sp|Q8H7Y6|HFA2D_ORYSJ Heat stress transcription factor A-2d OS=Oryza sativa subsp. japonica GN=HSFA2D PE=2 SV=2 19 138 4.0E-12
sp|Q6F388|HFA2E_ORYSJ Heat stress transcription factor A-2e OS=Oryza sativa subsp. japonica GN=HSFA2E PE=2 SV=1 19 224 4.0E-12
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 323 475 3.0E-11
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 316 462 3.0E-11
sp|Q5Z6A4|HFA6A_ORYSJ Putative heat stress transcription factor A-6a OS=Oryza sativa subsp. japonica GN=HSFA6A PE=3 SV=1 19 82 3.0E-11
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 352 468 5.0E-11
sp|P20134|SFL1_YEAST Flocculation suppression protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFL1 PE=1 SV=3 19 82 8.0E-11
sp|P46384|PILG_PSEAE Protein PilG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pilG PE=3 SV=1 352 468 1.0E-10
sp|Q6VBB2|HFA2B_ORYSJ Heat stress transcription factor A-2b OS=Oryza sativa subsp. japonica GN=HSFA2B PE=2 SV=1 19 121 1.0E-10
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 351 474 3.0E-10
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 335 464 4.0E-10
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 312 471 6.0E-10
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 352 470 6.0E-10
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 352 492 7.0E-10
sp|P53050|MGA1_YEAST Protein MGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA1 PE=3 SV=1 19 120 7.0E-10
sp|Q9M8Y4|ARR22_ARATH Two-component response regulator ARR22 OS=Arabidopsis thaliana GN=ARR22 PE=2 SV=1 348 474 9.0E-10
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 331 471 1.0E-09
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 351 474 1.0E-09
sp|Q7A0U4|SRRA_STAAW Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MW2) GN=srrA PE=3 SV=1 352 480 2.0E-09
sp|Q9L524|SRRA_STAAU Transcriptional regulatory protein SrrA OS=Staphylococcus aureus GN=srrA PE=2 SV=2 352 480 2.0E-09
sp|Q6G972|SRRA_STAAS Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MSSA476) GN=srrA PE=3 SV=2 352 480 2.0E-09
sp|Q6GGK6|SRRA_STAAR Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MRSA252) GN=srrA PE=3 SV=2 352 480 2.0E-09
sp|Q7A5H6|SRRA_STAAN Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain N315) GN=srrA PE=1 SV=1 352 480 2.0E-09
sp|Q7A2R6|SRRA_STAAM Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrA PE=3 SV=1 352 480 2.0E-09
sp|Q5HFT0|SRRA_STAAC Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain COL) GN=srrA PE=2 SV=1 352 480 2.0E-09
sp|Q2FY79|SRRA_STAA8 Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain NCTC 8325) GN=srrA PE=3 SV=1 352 480 2.0E-09
sp|Q75KW7|ORR41_ORYSJ Two-component response regulator ORR41 OS=Oryza sativa subsp. japonica GN=RR41 PE=3 SV=1 352 460 2.0E-09
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 299 474 3.0E-09
sp|Q9FK72|HFA4C_ARATH Heat stress transcription factor A-4c OS=Arabidopsis thaliana GN=HSFA4C PE=2 SV=1 19 194 3.0E-09
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 352 464 4.0E-09
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 352 464 4.0E-09
sp|P94413|YCLJ_BACSU Uncharacterized transcriptional regulatory protein YclJ OS=Bacillus subtilis (strain 168) GN=yclJ PE=3 SV=1 352 465 4.0E-09
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 339 454 5.0E-09
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 299 474 6.0E-09
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 352 488 6.0E-09
sp|Q9APD9|ZRAR_KLEOX Transcriptional regulatory protein ZraR OS=Klebsiella oxytoca GN=zraR PE=3 SV=1 352 513 8.0E-09
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 352 455 1.0E-08
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 328 465 2.0E-08
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 352 469 2.0E-08
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 352 464 4.0E-08
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 334 462 5.0E-08
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 352 468 5.0E-08
sp|Q5AK51|SFL2_CANAL Transcription factor SFL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFL2 PE=1 SV=2 19 82 7.0E-08
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 352 460 8.0E-08
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 352 460 8.0E-08
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 352 460 8.0E-08
sp|Q9CD68|MPRA_MYCLE Response regulator MprA OS=Mycobacterium leprae (strain TN) GN=mprA PE=3 SV=1 352 470 9.0E-08
sp|Q1B3X8|MPRA_MYCSS Response regulator MprA OS=Mycobacterium sp. (strain MCS) GN=mprA PE=3 SV=1 352 470 9.0E-08
sp|A1UL70|MPRA_MYCSK Response regulator MprA OS=Mycobacterium sp. (strain KMS) GN=mprA PE=3 SV=1 352 470 9.0E-08
sp|A3Q5L9|MPRA_MYCSJ Response regulator MprA OS=Mycobacterium sp. (strain JLS) GN=mprA PE=3 SV=1 352 470 9.0E-08
sp|P18769|FRZE_MYXXA Gliding motility regulatory protein OS=Myxococcus xanthus GN=frzE PE=1 SV=1 348 453 1.0E-07
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 340 460 1.0E-07
sp|A0R3I8|MPRA_MYCS2 Response regulator MprA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mprA PE=1 SV=1 352 470 1.0E-07
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 352 460 1.0E-07
sp|A1TEL7|MPRA_MYCVP Response regulator MprA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mprA PE=3 SV=1 352 470 1.0E-07
sp|Q8GP20|RSSB_SERMA Swarming motility regulation protein RssB OS=Serratia marcescens GN=rssB PE=1 SV=2 352 466 2.0E-07
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 332 468 2.0E-07
sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2 347 457 2.0E-07
sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1 347 457 2.0E-07
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 352 455 2.0E-07
sp|O49403|HFA4A_ARATH Heat stress transcription factor A-4a OS=Arabidopsis thaliana GN=HSFA4A PE=2 SV=1 19 194 2.0E-07
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 347 464 2.0E-07
sp|P0A4I0|DLTR_STRA5 Transcriptional regulatory protein DltR OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltR PE=3 SV=1 352 503 4.0E-07
sp|P0A4H9|DLTR_STRA3 Transcriptional regulatory protein DltR OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltR PE=3 SV=1 352 503 4.0E-07
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 352 468 4.0E-07
sp|P37478|YYCF_BACSU Transcriptional regulatory protein YycF OS=Bacillus subtilis (strain 168) GN=yycF PE=1 SV=1 352 491 6.0E-07
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 296 465 6.0E-07
sp|Q7A0I0|VRAR_STAAW Response regulator protein VraR OS=Staphylococcus aureus (strain MW2) GN=vraR PE=3 SV=1 353 465 7.0E-07
sp|Q6G850|VRAR_STAAS Response regulator protein VraR OS=Staphylococcus aureus (strain MSSA476) GN=vraR PE=3 SV=1 353 465 7.0E-07
sp|Q6GFH3|VRAR_STAAR Response regulator protein VraR OS=Staphylococcus aureus (strain MRSA252) GN=vraR PE=3 SV=1 353 465 7.0E-07
sp|Q7A4R9|VRAR_STAAN Response regulator protein VraR OS=Staphylococcus aureus (strain N315) GN=vraR PE=1 SV=1 353 465 7.0E-07
sp|Q7A2Q1|VRAR_STAAM Response regulator protein VraR OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=vraR PE=1 SV=1 353 465 7.0E-07
sp|P0C0Z1|VRAR_STAA1 Response regulator protein VraR OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=vraR PE=3 SV=1 353 465 7.0E-07
sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1 310 457 8.0E-07
sp|A1KHB7|MPRA_MYCBP Response regulator MprA OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mprA PE=3 SV=1 352 470 9.0E-07
sp|Q7U0X4|MPRA_MYCBO Response regulator MprA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mprA PE=1 SV=1 352 470 9.0E-07
sp|Q742C1|MPRA_MYCPA Response regulator MprA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprA PE=3 SV=1 352 470 9.0E-07
sp|A0QBQ9|MPRA_MYCA1 Response regulator MprA OS=Mycobacterium avium (strain 104) GN=mprA PE=3 SV=1 352 470 9.0E-07
sp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2 310 457 1.0E-06
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 349 464 1.0E-06
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 349 464 1.0E-06
sp|Q8D0P1|CHEY_YERPE Chemotaxis protein CheY OS=Yersinia pestis GN=cheY PE=3 SV=3 349 456 1.0E-06
sp|Q93P00|CHEY_YEREN Chemotaxis protein CheY OS=Yersinia enterocolitica GN=cheY PE=3 SV=3 349 456 1.0E-06
sp|P47175|HMS2_YEAST Probable transcription factor HMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMS2 PE=1 SV=1 19 117 1.0E-06
sp|O34903|YKOG_BACSU Uncharacterized transcriptional regulatory protein YkoG OS=Bacillus subtilis (strain 168) GN=ykoG PE=3 SV=1 352 470 2.0E-06
sp|Q9FAD7|CHEY_ENTCL Chemotaxis protein CheY OS=Enterobacter cloacae GN=cheY PE=3 SV=3 349 456 2.0E-06
sp|P43501|PILH_PSEAE Protein PilH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pilH PE=3 SV=1 352 469 2.0E-06
sp|Q50136|PRRA_MYCLE Transcriptional regulatory protein PrrA OS=Mycobacterium leprae (strain TN) GN=prrA PE=3 SV=2 369 491 3.0E-06
sp|Q06065|ATOC_ECOLI Acetoacetate metabolism regulatory protein AtoC OS=Escherichia coli (strain K12) GN=atoC PE=3 SV=2 352 471 3.0E-06
sp|P0A2D5|CHEY_SALTY Chemotaxis protein CheY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cheY PE=1 SV=2 349 456 3.0E-06
sp|P0A2D6|CHEY_SALTI Chemotaxis protein CheY OS=Salmonella typhi GN=cheY PE=3 SV=2 349 456 3.0E-06
sp|P54662|DEGU_BREBE Transcriptional regulatory protein DegU OS=Brevibacillus brevis GN=degU PE=3 SV=1 353 466 4.0E-06
sp|P9WGM1|PRRA_MYCTU Transcriptional regulatory protein PrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prrA PE=1 SV=1 369 491 5.0E-06
sp|P9WGM0|PRRA_MYCTO Transcriptional regulatory protein PrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prrA PE=3 SV=1 369 491 5.0E-06
sp|P0A5Z7|PRRA_MYCBO Transcriptional regulatory protein PrrA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prrA PE=3 SV=1 369 491 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003677 DNA binding No
GO:0010468 regulation of gene expression No
GO:0140110 transcription regulator activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0007165 signal transduction No
GO:0035556 intracellular signal transduction No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0097159 organic cyclic compound binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1834
MSATEMAAAQGVGNNASEFVRKLFRMLEDPSHQDVARWGKGGDTFVVVEGEKFTRSILPKHFKHSNMSSFIRQLN
KYDFHKVKPSSDSESSSPNGNILEFKHPYFRADSKDGLDNIRRKAPAPRKPQAAEDFTTSQHVSVVSEQLTATQQ
QVQQLQEMYNDASQANRLLANEIMTLQRALHTQNKAQFEILNFLNLYGDGRSRALMGQALSSNGTGDVDDSAPEL
RRARELLSSVTTDSMADRELERLHGSYASPAGSTAIITPVSMPMLHDPINDLGRYPVYPVGQTVGIDPFHSDHIH
KIPYAMPSDGSPLGVSEAAGSAAAPAPTNPTSAPSTPLDKPSSLWGPKKPLIFLVEDDPTCAKIGIKFLKSMGCE
VEHAQNGADAYSRVSNVGRDHFDMIFMDIIMPQLDGVSATTYIRQHCPSTPIIAMTSNIRPDEVNGYFEHGMNGV
LAKPFTKEGMLKSVKTQLSHLLKSPPLAHDGDGSRYMVGNVPFMNNSIKLETPTPPPGSAGSGWSPGHMGHNSVD
QCYGLLNGGAQYGMGRQHYGTTMDTASGRLSDHDSPPEKRQRLNASQGNYG*
Coding >OphauB2|1834
ATGTCGGCTACAGAGATGGCCGCCGCCCAAGGGGTAGGCAACAATGCGAGCGAATTTGTCCGCAAGCTCTTCCGC
ATGCTCGAAGATCCATCGCACCAAGATGTAGCCCGATGGGGAAAGGGTGGCGACACGTTTGTTGTGGTGGAGGGC
GAAAAGTTTACAAGATCGATATTACCCAAGCATTTCAAGCATAGCAACATGTCTAGCTTTATCCGACAGCTTAAT
AAATACGACTTCCACAAAGTCAAGCCCTCGAGTGATAGCGAATCGTCAAGCCCCAACGGAAACATTCTGGAGTTC
AAGCACCCTTATTTCCGAGCAGACAGTAAAGATGGACTGGATAATATTCGTCGAAAGGCCCCAGCGCCGAGAAAA
CCTCAAGCAGCTGAAGACTTCACCACCAGTCAACACGTGAGCGTTGTATCTGAACAGCTCACTGCCACCCAACAA
CAGGTGCAGCAGCTACAGGAAATGTACAATGATGCATCACAAGCAAACAGGCTTCTTGCCAATGAGATCATGACA
CTGCAGAGGGCGCTTCATACCCAGAACAAGGCACAGTTTGAAATCCTCAACTTTCTCAACCTGTACGGCGACGGT
AGGAGTCGGGCGCTCATGGGTCAAGCCCTGAGCTCCAATGGCACGGGAGATGTAGACGATTCTGCCCCTGAATTG
CGCCGAGCGCGCGAACTGCTCTCGAGCGTTACCACGGACTCGATGGCTGATCGTGAACTAGAACGACTACACGGC
TCATACGCGTCTCCCGCCGGCTCAACTGCCATCATCACACCCGTGTCAATGCCCATGCTCCACGATCCTATTAAT
GACCTTGGTCGATATCCAGTGTATCCCGTAGGGCAAACAGTGGGTATTGATCCATTTCACTCGGACCATATTCAC
AAAATACCCTATGCCATGCCTAGTGACGGATCACCCTTGGGAGTGTCTGAAGCTGCAGGCTCTGCGGCAGCGCCT
GCGCCCACAAATCCCACTTCGGCTCCCTCAACGCCCTTGGATAAACCGAGCTCCCTATGGGGGCCCAAGAAGCCT
CTTATATTCCTCGTCGAGGATGATCCCACATGCGCAAAGATTGGCATCAAGTTTTTGAAGTCAATGGGCTGCGAG
GTTGAGCATGCTCAAAACGGCGCCGACGCCTATAGCAGAGTTAGCAACGTTGGCCGCGATCACTTTGACATGATT
TTTATGGACATCATCATGCCACAGCTTGACGGCGTCTCGGCAACCACGTACATACGCCAACATTGTCCATCGACA
CCCATCATCGCCATGACATCCAACATCAGACCTGATGAAGTGAATGGCTACTTCGAGCACGGAATGAACGGGGTG
TTGGCCAAACCATTTACCAAGGAGGGAATGCTAAAATCGGTCAAGACCCAATTGTCGCACCTTTTGAAGTCACCG
CCTCTGGCGCACGACGGCGATGGCTCGCGATACATGGTGGGAAATGTGCCCTTCATGAATAATTCGATCAAGCTC
GAAACTCCGACTCCACCGCCAGGCTCAGCAGGCTCTGGCTGGTCACCTGGACACATGGGACACAACAGCGTCGAT
CAGTGCTACGGTCTCTTAAATGGCGGGGCTCAGTACGGCATGGGCCGGCAACATTACGGCACCACCATGGACACT
GCCTCGGGGCGATTATCGGATCATGATAGTCCACCAGAGAAGCGACAGCGGCTGAATGCAAGCCAGGGAAACTAC
GGCTGA
Transcript >OphauB2|1834
ATGTCGGCTACAGAGATGGCCGCCGCCCAAGGGGTAGGCAACAATGCGAGCGAATTTGTCCGCAAGCTCTTCCGC
ATGCTCGAAGATCCATCGCACCAAGATGTAGCCCGATGGGGAAAGGGTGGCGACACGTTTGTTGTGGTGGAGGGC
GAAAAGTTTACAAGATCGATATTACCCAAGCATTTCAAGCATAGCAACATGTCTAGCTTTATCCGACAGCTTAAT
AAATACGACTTCCACAAAGTCAAGCCCTCGAGTGATAGCGAATCGTCAAGCCCCAACGGAAACATTCTGGAGTTC
AAGCACCCTTATTTCCGAGCAGACAGTAAAGATGGACTGGATAATATTCGTCGAAAGGCCCCAGCGCCGAGAAAA
CCTCAAGCAGCTGAAGACTTCACCACCAGTCAACACGTGAGCGTTGTATCTGAACAGCTCACTGCCACCCAACAA
CAGGTGCAGCAGCTACAGGAAATGTACAATGATGCATCACAAGCAAACAGGCTTCTTGCCAATGAGATCATGACA
CTGCAGAGGGCGCTTCATACCCAGAACAAGGCACAGTTTGAAATCCTCAACTTTCTCAACCTGTACGGCGACGGT
AGGAGTCGGGCGCTCATGGGTCAAGCCCTGAGCTCCAATGGCACGGGAGATGTAGACGATTCTGCCCCTGAATTG
CGCCGAGCGCGCGAACTGCTCTCGAGCGTTACCACGGACTCGATGGCTGATCGTGAACTAGAACGACTACACGGC
TCATACGCGTCTCCCGCCGGCTCAACTGCCATCATCACACCCGTGTCAATGCCCATGCTCCACGATCCTATTAAT
GACCTTGGTCGATATCCAGTGTATCCCGTAGGGCAAACAGTGGGTATTGATCCATTTCACTCGGACCATATTCAC
AAAATACCCTATGCCATGCCTAGTGACGGATCACCCTTGGGAGTGTCTGAAGCTGCAGGCTCTGCGGCAGCGCCT
GCGCCCACAAATCCCACTTCGGCTCCCTCAACGCCCTTGGATAAACCGAGCTCCCTATGGGGGCCCAAGAAGCCT
CTTATATTCCTCGTCGAGGATGATCCCACATGCGCAAAGATTGGCATCAAGTTTTTGAAGTCAATGGGCTGCGAG
GTTGAGCATGCTCAAAACGGCGCCGACGCCTATAGCAGAGTTAGCAACGTTGGCCGCGATCACTTTGACATGATT
TTTATGGACATCATCATGCCACAGCTTGACGGCGTCTCGGCAACCACGTACATACGCCAACATTGTCCATCGACA
CCCATCATCGCCATGACATCCAACATCAGACCTGATGAAGTGAATGGCTACTTCGAGCACGGAATGAACGGGGTG
TTGGCCAAACCATTTACCAAGGAGGGAATGCTAAAATCGGTCAAGACCCAATTGTCGCACCTTTTGAAGTCACCG
CCTCTGGCGCACGACGGCGATGGCTCGCGATACATGGTGGGAAATGTGCCCTTCATGAATAATTCGATCAAGCTC
GAAACTCCGACTCCACCGCCAGGCTCAGCAGGCTCTGGCTGGTCACCTGGACACATGGGACACAACAGCGTCGAT
CAGTGCTACGGTCTCTTAAATGGCGGGGCTCAGTACGGCATGGGCCGGCAACATTACGGCACCACCATGGACACT
GCCTCGGGGCGATTATCGGATCATGATAGTCCACCAGAGAAGCGACAGCGGCTGAATGCAAGCCAGGGAAACTAC
GGCTGA
Gene >OphauB2|1834
ATGTCGGCTACAGAGATGGCCGCCGCCCAAGGGGTAGGCAACAATGCGAGCGAATTTGTGGGTCGCAACGACTGT
TTTCTGACATCGTAGTAGTAAGAAGCGCTGACTGACCGGCCGACTGCAGGTCCGCAAGCTCTTCCGGTGATGCAC
CTCGCTGGCGCGCCATGAATGTTACTCCTCCAGCTAACCCGCGGCTCTCAGCATGCTCGAAGATCCATCGCACCA
AGATGTAGCCCGATGGGGAAAGGGTGGCGACACGTTTGTTGTGGTGGAGGTAGCTGCAAAAGCGCTCCATTTTGA
CCCGACTCCCCCTCTGCTGACGTTGGTCCAGGGCGAAAAGTTTACAAGATCGATATTACCCAAGCATTTCAAGCA
TAGCAACATGTCTAGCTTTATCCGACAGCTTAATAAATACGACTTCCACAAAGTCAAGCCCTCGAGTGATAGCGA
ATCGTCAAGCCCCAACGGAAACGTGAGATTTGGCGAGGACCAGATGTAGCTCAAGTGGCCCAAAGAGCTAATCAA
AAACTGGCAGATTCTGGAGTTCAAGCACCCTTATTTCCGAGCAGACAGTAAAGATGGACTGGATAATATTCGTCG
AAAGGCCCCAGCGCCGAGAAAACCTCAAGCAGCTGAAGACTTCACCACCAGTCAACACGTGAGCGTTGTATCTGA
ACAGCTCACTGCCACCCAACAACAGGTGCAGCAGCTACAGGAAATGTACAATGATGCATCACAAGCAAACAGGCT
TCTTGCCAATGAGATCATGACACTGCAGAGGGCGCTTCATACCCAGAACAAGGCACAGTTTGAAATCCTCAACTT
TCTCAACCTGTACGGCGACGGTAGGAGTCGGGCGCTCATGGGTCAAGCCCTGAGCTCCAATGGCACGGGAGATGT
AGACGATTCTGCCCCTGAATTGCGCCGAGCGCGCGAACTGCTCTCGAGCGTTACCACGGACTCGATGGCTGATCG
TGAACTAGAACGACTACACGGCTCATACGCGTCTCCCGCCGGCTCAACTGCCATCATCACACCCGTGTCAATGCC
CATGCTCCACGATCCTATTAATGACCTTGGTCGATATCCAGTGTATCCCGTAGGGCAAACAGTGGGTATTGATCC
ATTTCACTCGGACCATATTCACAAAATACCCTATGCCATGCCTAGTGACGGATCACCCTTGGGAGTGTCTGAAGC
TGCAGGCTCTGCGGCAGCGCCTGCGCCCACAAATCCCACTTCGGCTCCCTCAACGCCCTTGGATAAACCGAGCTC
CCTATGGGGGCCCAAGAAGCCTCTTATATTCCTCGTCGAGGATGATCCCACATGCGCAAAGATTGGCATCAAGTT
TTTGAAGTCAATGGGCTGCGAGGTTGAGCATGCTGTGAGTTACCCCTGGGGCTCGCACCCACGCTCGTGCCTAGG
ACAAGTCTCTTGGCTGACACGGCAATGCAGCAAAACGGCGCCGACGCCTATAGCAGAGTTAGCAACGTTGGCCGC
GATCACTTTGACATGATTTTTATGGACATCATCATGCCACAGCTTGACGGCGTCTCGGCAACCACGTACATACGC
CAACATTGTCCATCGACACCCATCATCGCCATGACATCCAACATCAGACCTGATGAAGTGAATGGCTACTTCGAG
CACGGTACGTCAGATTGTTTCCCAAAATACTACAGGCTAACACACAATCATAGGAATGAACGGGGTGTTGGCCAA
ACCATTTACCAAGGAGGGAATGCTAAAATCGGTCAAGACCCAATTGTCGCACCTTTTGAAGTCACCGCCTCTGGC
GCACGACGGCGATGGCTCGCGATACATGGTGGGAAATGTGCCCTTCATGAATAATTCGATCAAGCTCGAAACTCC
GACTCCACCGCCAGGCTCAGCAGGCTCTGGCTGGTCACCTGGACACATGGGACACAACAGCGTCGATCAGTGCTA
CGGTCTCTTAAATGGCGGGGCTCAGTACGGCATGGGCCGGCAACATTACGGCACCACCATGGACACTGCCTCGGG
GCGATTATCGGATCATGATAGTCCACCAGAGAAGCGACAGCGGCTGAATGCAAGCCAGGGAAACTACGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail