Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1833
Gene name
LocationContig_151:28602..30872
Strand-
Gene length (bp)2270
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon 1.2E-19 635 719

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 18 712 2.0E-121
sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 1 710 2.0E-112
sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1 10 713 3.0E-100
sp|Q54RF3|EI2BE_DICDI Translation initiation factor eIF-2B subunit epsilon OS=Dictyostelium discoideum GN=eif2b5 PE=3 SV=1 6 431 9.0E-88
sp|P47823|EI2BE_RABIT Translation initiation factor eIF-2B subunit epsilon OS=Oryctolagus cuniculus GN=EIF2B5 PE=1 SV=1 20 710 2.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 18 712 2.0E-121
sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 1 710 2.0E-112
sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1 10 713 3.0E-100
sp|Q54RF3|EI2BE_DICDI Translation initiation factor eIF-2B subunit epsilon OS=Dictyostelium discoideum GN=eif2b5 PE=3 SV=1 6 431 9.0E-88
sp|P47823|EI2BE_RABIT Translation initiation factor eIF-2B subunit epsilon OS=Oryctolagus cuniculus GN=EIF2B5 PE=1 SV=1 20 710 2.0E-87
sp|Q13144|EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens GN=EIF2B5 PE=1 SV=3 27 438 7.0E-83
sp|Q64350|EI2BE_RAT Translation initiation factor eIF-2B subunit epsilon OS=Rattus norvegicus GN=Eif2b5 PE=1 SV=2 27 438 8.0E-83
sp|Q8CHW4|EI2BE_MOUSE Translation initiation factor eIF-2B subunit epsilon OS=Mus musculus GN=Eif2b5 PE=1 SV=1 27 438 9.0E-82
sp|Q54FQ8|EI2BG_DICDI Translation initiation factor eIF-2B subunit gamma OS=Dictyostelium discoideum GN=eif2b3 PE=3 SV=1 23 407 3.0E-13
sp|B0CM52|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1 26 409 6.0E-09
sp|Q96IJ6|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1 26 409 7.0E-09
sp|P56288|EI2BG_SCHPO Probable translation initiation factor eIF-2B subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif223 PE=1 SV=2 14 408 8.0E-09
sp|O60064|YBB2_SCHPO Probable mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.02 PE=3 SV=1 29 423 1.0E-08
sp|Q7SXP8|GMPAB_DANRE Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1 26 391 2.0E-08
sp|Q4R6T3|EI2BG_MACFA Translation initiation factor eIF-2B subunit gamma OS=Macaca fascicularis GN=EIF2B3 PE=2 SV=1 27 439 2.0E-08
sp|C4Z4L8|GLGC_EUBE2 Glucose-1-phosphate adenylyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=glgC PE=3 SV=1 312 437 4.0E-07
sp|P37820|MPG1_SULAC Putative mannose-1-phosphate guanyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=mpg1 PE=3 SV=2 26 158 4.0E-07
sp|B7IFV2|GLGC_THEAB Glucose-1-phosphate adenylyltransferase OS=Thermosipho africanus (strain TCF52B) GN=glgC PE=3 SV=1 311 444 4.0E-06
sp|O08327|GLGD_GEOSE Glycogen biosynthesis protein GlgD OS=Geobacillus stearothermophilus GN=glgD PE=3 SV=1 286 419 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1833
MSHKGKNSAKGKKPVKAGVERKTENLLQAVILADSFQDRFKPFTVEKPRCLLPLANTPLIEHTLEFLAMNGVDEV
FIYCGSHTKQVEEYVSRSRWATPSPSCPFSLLQFVRVADARSAGDVLRDMDKRSLVDGDFILVHGDLVSNLMLDR
ALSAHRQRREANPANIMTMVLRSGGDQDHRTKAKAITPVFVVDTESQRVLHYDEMNPLQSDPHIYLDLSILDELS
TDFEMRADLIDAHIDICTPEVLALWSESFDYELPRRNFLHGVLKDWELNGKMIYADIVDQGYAARANNLQMYKAI
SHDVLGRWAYPLVPENNLMSKQLYRVHTETVVMEQGASYASDASVDNSIIGQDSTIASSCRISNSVIGRGCKIGV
GAVIEDSCIWDNTIVGDGARIAHSLLADSVVVGKNCIISPGSLISFGVKIGHDTKLTNQVVLSTCSSTGQAVTGD
TRLLGPNTNAAVFLDDDDDELDERDPARLQKSLIYSMANMNISTPSVSTMDSAAATDDEDDAQATSGDAAMSSRS
RLSSFASDESSGRMSFHADAVHGLVDALRSESGDFDSAKLEFMGLRLANDASDAMMRKAVATAFARRAAELLLPE
YGSLEPAKAAEKALTARQGATKFIDEVGVGGGEPEQLEFVLELQRALLHVKHVEPARLGTVLAALMQQLYALDIL
EEEGILGWWQDERAVEGDAMAALKHKCQVLVEWLENAEEEDDDSD*
Coding >OphauB2|1833
ATGTCTCACAAGGGCAAGAACAGCGCCAAGGGGAAAAAGCCCGTCAAGGCAGGTGTCGAACGTAAGACGGAGAAT
CTCTTACAGGCCGTTATTCTAGCAGATTCGTTTCAAGATAGATTCAAGCCCTTCACGGTCGAGAAGCCACGATGT
CTCCTTCCACTAGCCAACACACCCCTTATCGAACATACGCTCGAATTTCTTGCCATGAATGGTGTCGATGAAGTC
TTCATCTATTGTGGCTCACACACAAAACAAGTCGAGGAATACGTCAGCCGCTCGCGATGGGCTACGCCATCTCCA
TCCTGTCCCTTTTCGCTCCTGCAGTTTGTCCGCGTGGCCGATGCAAGGTCGGCTGGCGATGTTCTTCGAGACATG
GACAAACGATCACTGGTGGATGGCGACTTCATCCTGGTGCATGGAGATCTCGTCTCCAACCTGATGCTAGACCGT
GCTCTGTCAGCGCATCGCCAAAGAAGAGAGGCCAACCCGGCCAACATCATGACCATGGTTCTTCGCAGTGGAGGC
GACCAAGACCATAGAACAAAAGCAAAGGCCATAACACCAGTCTTCGTTGTCGACACAGAGAGCCAACGCGTTTTG
CACTACGATGAAATGAATCCTCTACAGAGCGACCCCCACATCTACCTCGATCTCTCTATCCTTGACGAGCTCTCA
ACCGACTTTGAAATGCGGGCCGATCTAATTGATGCCCACATTGATATTTGCACTCCAGAGGTCCTTGCACTTTGG
TCTGAAAGCTTCGACTATGAGTTGCCCCGGCGCAACTTTCTTCACGGCGTGCTCAAGGACTGGGAGCTCAATGGC
AAGATGATATACGCCGATATTGTAGACCAAGGATATGCTGCCCGTGCCAATAACCTCCAAATGTACAAGGCCATC
AGTCACGATGTCCTTGGCCGATGGGCGTACCCGCTCGTGCCCGAGAACAATCTGATGTCTAAGCAGCTGTATCGT
GTGCACACGGAAACTGTCGTCATGGAACAGGGTGCGTCTTATGCCTCTGACGCCAGTGTTGACAACTCTATTATT
GGGCAAGACTCAACTATTGCATCGTCTTGCAGAATATCGAACAGCGTCATTGGAAGGGGCTGCAAAATCGGCGTC
GGGGCTGTGATCGAGGACTCTTGCATATGGGACAACACAATCGTTGGCGATGGTGCTCGAATTGCGCACTCCCTT
CTTGCCGACTCTGTAGTTGTTGGGAAGAACTGCATTATCTCGCCCGGCTCGCTGATTTCATTTGGAGTCAAAATC
GGCCATGATACCAAGTTGACCAATCAAGTGGTCTTGTCTACGTGCTCCTCTACTGGACAAGCTGTCACAGGAGAT
ACACGTCTTCTCGGGCCCAACACCAACGCAGCCGTGTTCCTTGATGACGATGACGATGAGCTGGACGAGCGAGAC
CCTGCTCGCCTGCAAAAGTCTCTCATATACTCCATGGCCAATATGAACATTTCCACGCCCTCAGTCTCAACAATG
GACTCGGCCGCCGCGACAGACGACGAAGACGACGCCCAGGCTACGTCTGGAGATGCCGCAATGTCTTCACGCTCG
CGCCTGTCATCTTTTGCGTCGGACGAGTCGTCAGGCAGAATGTCGTTTCACGCGGACGCTGTGCATGGCCTGGTT
GATGCTCTACGCTCCGAGTCGGGCGATTTTGACTCTGCTAAACTCGAGTTCATGGGCCTCCGGCTCGCCAATGAC
GCATCCGACGCCATGATGCGAAAAGCCGTTGCCACAGCATTTGCCCGGCGCGCTGCCGAGCTGTTGTTGCCTGAG
TATGGCTCCTTGGAACCTGCAAAGGCGGCTGAAAAAGCTTTGACGGCGCGCCAGGGCGCCACCAAGTTCATTGAT
GAAGTAGGCGTTGGCGGTGGAGAGCCGGAGCAACTGGAATTCGTCCTCGAGCTTCAACGAGCACTGCTGCACGTC
AAGCACGTCGAGCCTGCACGGCTGGGGACGGTGTTGGCGGCCTTGATGCAGCAGCTATACGCTCTCGACATTCTT
GAGGAAGAGGGCATCCTGGGTTGGTGGCAGGACGAACGGGCTGTCGAGGGTGACGCCATGGCTGCGCTCAAGCAC
AAGTGCCAAGTGCTGGTGGAATGGTTGGAGAATGCTGAGGAAGAAGATGACGATAGCGACTGA
Transcript >OphauB2|1833
ATGTCTCACAAGGGCAAGAACAGCGCCAAGGGGAAAAAGCCCGTCAAGGCAGGTGTCGAACGTAAGACGGAGAAT
CTCTTACAGGCCGTTATTCTAGCAGATTCGTTTCAAGATAGATTCAAGCCCTTCACGGTCGAGAAGCCACGATGT
CTCCTTCCACTAGCCAACACACCCCTTATCGAACATACGCTCGAATTTCTTGCCATGAATGGTGTCGATGAAGTC
TTCATCTATTGTGGCTCACACACAAAACAAGTCGAGGAATACGTCAGCCGCTCGCGATGGGCTACGCCATCTCCA
TCCTGTCCCTTTTCGCTCCTGCAGTTTGTCCGCGTGGCCGATGCAAGGTCGGCTGGCGATGTTCTTCGAGACATG
GACAAACGATCACTGGTGGATGGCGACTTCATCCTGGTGCATGGAGATCTCGTCTCCAACCTGATGCTAGACCGT
GCTCTGTCAGCGCATCGCCAAAGAAGAGAGGCCAACCCGGCCAACATCATGACCATGGTTCTTCGCAGTGGAGGC
GACCAAGACCATAGAACAAAAGCAAAGGCCATAACACCAGTCTTCGTTGTCGACACAGAGAGCCAACGCGTTTTG
CACTACGATGAAATGAATCCTCTACAGAGCGACCCCCACATCTACCTCGATCTCTCTATCCTTGACGAGCTCTCA
ACCGACTTTGAAATGCGGGCCGATCTAATTGATGCCCACATTGATATTTGCACTCCAGAGGTCCTTGCACTTTGG
TCTGAAAGCTTCGACTATGAGTTGCCCCGGCGCAACTTTCTTCACGGCGTGCTCAAGGACTGGGAGCTCAATGGC
AAGATGATATACGCCGATATTGTAGACCAAGGATATGCTGCCCGTGCCAATAACCTCCAAATGTACAAGGCCATC
AGTCACGATGTCCTTGGCCGATGGGCGTACCCGCTCGTGCCCGAGAACAATCTGATGTCTAAGCAGCTGTATCGT
GTGCACACGGAAACTGTCGTCATGGAACAGGGTGCGTCTTATGCCTCTGACGCCAGTGTTGACAACTCTATTATT
GGGCAAGACTCAACTATTGCATCGTCTTGCAGAATATCGAACAGCGTCATTGGAAGGGGCTGCAAAATCGGCGTC
GGGGCTGTGATCGAGGACTCTTGCATATGGGACAACACAATCGTTGGCGATGGTGCTCGAATTGCGCACTCCCTT
CTTGCCGACTCTGTAGTTGTTGGGAAGAACTGCATTATCTCGCCCGGCTCGCTGATTTCATTTGGAGTCAAAATC
GGCCATGATACCAAGTTGACCAATCAAGTGGTCTTGTCTACGTGCTCCTCTACTGGACAAGCTGTCACAGGAGAT
ACACGTCTTCTCGGGCCCAACACCAACGCAGCCGTGTTCCTTGATGACGATGACGATGAGCTGGACGAGCGAGAC
CCTGCTCGCCTGCAAAAGTCTCTCATATACTCCATGGCCAATATGAACATTTCCACGCCCTCAGTCTCAACAATG
GACTCGGCCGCCGCGACAGACGACGAAGACGACGCCCAGGCTACGTCTGGAGATGCCGCAATGTCTTCACGCTCG
CGCCTGTCATCTTTTGCGTCGGACGAGTCGTCAGGCAGAATGTCGTTTCACGCGGACGCTGTGCATGGCCTGGTT
GATGCTCTACGCTCCGAGTCGGGCGATTTTGACTCTGCTAAACTCGAGTTCATGGGCCTCCGGCTCGCCAATGAC
GCATCCGACGCCATGATGCGAAAAGCCGTTGCCACAGCATTTGCCCGGCGCGCTGCCGAGCTGTTGTTGCCTGAG
TATGGCTCCTTGGAACCTGCAAAGGCGGCTGAAAAAGCTTTGACGGCGCGCCAGGGCGCCACCAAGTTCATTGAT
GAAGTAGGCGTTGGCGGTGGAGAGCCGGAGCAACTGGAATTCGTCCTCGAGCTTCAACGAGCACTGCTGCACGTC
AAGCACGTCGAGCCTGCACGGCTGGGGACGGTGTTGGCGGCCTTGATGCAGCAGCTATACGCTCTCGACATTCTT
GAGGAAGAGGGCATCCTGGGTTGGTGGCAGGACGAACGGGCTGTCGAGGGTGACGCCATGGCTGCGCTCAAGCAC
AAGTGCCAAGTGCTGGTGGAATGGTTGGAGAATGCTGAGGAAGAAGATGACGATAGCGACTGA
Gene >OphauB2|1833
ATGTCTCACAAGGGCAAGAACAGCGCCAAGGGGAAAAAGCCCGTCAAGGCAGGTGTCGAACGTAAGACGGAGAAT
CTCTTACAGGCCGTTGTACGTGTGTGTCGCGTCTGGTTGGGTTAGATGCGCGCTGACTAGGAAATACAGATTCTA
GCAGATTCGTTTCAAGATAGATTCAAGCCCTTCACGGTCGAGAAGCCACGAGTAAGGTGTTTCCGCATTTCGCTT
GGGCACAAGCTCACATATCACTTCCTTAGTGTCTCCTTCCACTAGCCAACACACCCCTTATCGAACATACGCTCG
AATTTCTTGCCATGAATGGTGTCGATGAAGTCTTCATCTATTGTGGCTCACACACAAAACAAGTCGAGGAATACG
TCAGCCGCTCGCGATGGGCTACGCCATCTCCATCCTGTCCCTTTTCGCTCCTGCAGTTTGTCCGCGTGGCCGATG
CAAGGTCGGCTGGCGATGTTCTTCGAGACATGGACAAACGATCACTGGTGGATGGCGACTTCATCCTGGTGCATG
GAGATCTCGTCTCCAACCTGATGCTAGACCGTGCTCTGTCAGCGCATCGCCAAAGAAGAGAGGCCAACCCGGCCA
ACATCATGACCATGGTTCTTCGCAGTGGAGGCGACCAAGACCATAGAACAAAAGCAAAGGCCATAACACCAGTCT
TCGTTGTCGACACAGAGAGCCAACGCGTTTTGCACTACGATGAAATGAATCCTCTACAGAGCGACCCCCACATCT
ACCTCGATCTCTCTATCCTTGACGAGCTCTCAACCGACTTTGAAATGCGGGCCGATCTAATTGATGCCCACATTG
ATATTTGCACTCCAGAGGTCCTTGCACTTTGGTCTGAAAGCTTCGACTATGAGTTGCCCCGGCGCAACTTTCTTC
ACGGCGTGCTCAAGGACTGGGAGCTCAATGGCAAGATGATATACGCCGATATTGTAGACCAAGGATATGCTGCCC
GTGCCAATAACCTCCAAATGTACAAGGCCATCAGTCACGATGTCCTTGGCCGATGGGCGTACCCGCTCGTGCCCG
AGAACAATCTGATGTCTAAGCAGCTGTATCGTGTGCACACGGAAACTGTCGTCATGGAACAGGGTGCGTCTTATG
CCTCTGACGCCAGTGTTGACAACTCTATTATTGGGCAAGACTCAACTATTGCATCGTCTTGCAGAATATCGAACA
GCGTCATTGGAAGGGGCTGCAAAATCGGCGTCGGGGCTGTGATCGAGGACTCTTGCATATGGGACAACACAATCG
TTGGCGATGGTGCTCGAATTGCGCACTCCCTTCTTGCCGACTCTGTAGTTGTTGGGAAGAACTGCATTATCTCGC
CCGGCTCGCTGATTTCATTTGGAGTCAAAATCGGCCATGATACCAAGTTGACCAATCAAGTGGTCTTGTCTACGT
GCTCCTCTACTGGACAAGCTGTCACAGGAGATACACGTCTTCTCGGGCCCAACACCAACGCAGCCGTGTTCCTTG
ATGACGATGACGATGAGCTGGACGAGCGAGACCCTGCTCGCCTGCAAAAGTCTCTCATATACTCCATGGCCAATA
TGAACATTTCCACGCCCTCAGTCTCAACAATGGACTCGGCCGCCGCGACAGACGACGAAGACGACGCCCAGGCTA
CGTCTGGAGATGCCGCAATGTCTTCACGCTCGCGCCTGTCATCTTTTGCGTCGGACGAGTCGTCAGGCAGAATGT
CGTTTCACGCGGACGCTGTGCATGGCCTGGTTGATGCTCTACGCTCCGAGTCGGGCGATTTTGACTCTGCTAAAC
TCGAGTTCATGGGCCTCCGGCTCGCCAATGACGCATCCGACGCCATGATGCGAAAAGCCGTTGCCACAGCATTTG
CCCGGCGCGCTGCCGAGCTGTTGTTGCCTGAGTATGGCTCCTTGGAACCTGCAAAGGCGGCTGAAAAAGCTTTGA
CGGCGCGCCAGGGCGCCACCAAGTTCATTGATGAAGTAGGCGTTGGCGGTGGAGAGCCGGAGCAACTGGAATTCG
TCCTCGAGCTTCAACGAGCACTGCTGCACGTCAAGCACGTCGAGCCTGCACGGCTGGGGACGGTGTTGGCGGCCT
TGATGCAGCAGCTATACGCTCTCGACATTCTTGAGGAAGAGGGCATCCTGGGTTGGTGGCAGGACGAACGGGCTG
TCGAGGGTGACGCCATGGCTGCGCTCAAGCACAAGTGCCAAGTGCTGGTGGAATGGTTGGAGAATGCTGAGGAAG
AAGATGACGATAGCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail