Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1820
Gene name
LocationContig_150:50056..51234
Strand-
Gene length (bp)1178
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13938|YEP4_SCHPO UPF0658 Golgi apparatus membrane protein C23H3.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H3.04 PE=3 SV=3 17 317 7.0E-53
sp|Q9UUJ8|YLOA_SCHPO UPF0658 Golgi apparatus membrane protein C1952.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.10c PE=3 SV=1 11 351 4.0E-33

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 61 80 19
3 87 109 22
4 142 164 22
5 190 212 22
6 222 241 19
7 248 266 18
8 286 308 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1820
MHRDTMGFLHSKWPAAFMAVTGVQALICLGFESYVFAKFQTSLASKQLSTDSMVQSQYKTIPTFLTLFIFGFLYE
LVVVWDALRMKNTIQVIGVCIANLALLVYTAIQVDQIQAAIFVLASRGALKRQFTADDVLSDVKPFLIAIPAIIA
LATVVMVFIAWKLYQEFAWDILKNIGADYRMKKRFLDYQIYIALLKFDFFFFLGFIIQFVVIVAQKTDPEFALTI
ATIPITIIILLLAAYFTRRESKWGMIAVIILYFGGLTYFIFKLVRIYDPKTRDEYMAVRKSLTAFAVITILLIIL
TIANAIICMRNFNNGLKMHLQSPRREEEKPDMHSISLHDVKPQLPSRMTID*
Coding >OphauB2|1820
ATGCATCGCGACACCATGGGTTTCCTCCACTCCAAATGGCCTGCTGCCTTTATGGCTGTCACGGGCGTCCAGGCC
CTAATATGTCTGGGTTTTGAGTCTTATGTCTTTGCCAAGTTTCAGACGAGCCTGGCCTCGAAACAACTCTCAACC
GACTCCATGGTGCAGTCGCAGTACAAGACAATTCCCACCTTTTTGACTCTCTTTATATTCGGCTTCCTCTACGAA
CTCGTCGTTGTCTGGGACGCCCTGCGCATGAAGAATACCATTCAAGTCATTGGCGTCTGCATCGCCAACCTCGCT
CTCTTGGTCTACACGGCCATTCAAGTCGATCAGATCCAGGCGGCAATCTTCGTCTTGGCTTCCCGCGGTGCCCTC
AAGCGCCAGTTCACCGCCGACGACGTCTTGTCAGATGTCAAGCCCTTCCTCATTGCCATTCCTGCCATTATTGCC
TTGGCCACTGTTGTCATGGTATTTATTGCCTGGAAGCTCTACCAAGAATTTGCCTGGGATATTCTCAAGAATATC
GGCGCAGATTATCGCATGAAGAAGCGCTTCCTTGACTACCAGATTTACATTGCCCTGCTTAAATTCGACTTCTTC
TTCTTTCTCGGCTTCATTATCCAATTCGTCGTTATTGTCGCTCAAAAGACGGACCCCGAGTTTGCTCTGACTATT
GCCACTATACCCATCACCATCATCATCCTGCTCCTTGCCGCCTACTTTACGCGTAGGGAGAGCAAGTGGGGAATG
ATTGCCGTTATTATTCTCTACTTTGGCGGTCTCACCTACTTCATCTTCAAACTTGTCCGCATCTACGACCCCAAG
ACTCGAGACGAATACATGGCTGTTCGCAAGTCTCTGACTGCCTTTGCCGTTATTACCATTCTCTTGATCATTCTC
ACCATTGCCAATGCCATTATTTGCATGCGCAACTTTAATAATGGCCTCAAGATGCATTTGCAGTCGCCGCGAAGA
GAGGAGGAGAAGCCAGACATGCACTCGATTAGCCTGCACGACGTTAAGCCTCAACTACCTAGTCGCATGACGATT
GACTAG
Transcript >OphauB2|1820
ATGCATCGCGACACCATGGGTTTCCTCCACTCCAAATGGCCTGCTGCCTTTATGGCTGTCACGGGCGTCCAGGCC
CTAATATGTCTGGGTTTTGAGTCTTATGTCTTTGCCAAGTTTCAGACGAGCCTGGCCTCGAAACAACTCTCAACC
GACTCCATGGTGCAGTCGCAGTACAAGACAATTCCCACCTTTTTGACTCTCTTTATATTCGGCTTCCTCTACGAA
CTCGTCGTTGTCTGGGACGCCCTGCGCATGAAGAATACCATTCAAGTCATTGGCGTCTGCATCGCCAACCTCGCT
CTCTTGGTCTACACGGCCATTCAAGTCGATCAGATCCAGGCGGCAATCTTCGTCTTGGCTTCCCGCGGTGCCCTC
AAGCGCCAGTTCACCGCCGACGACGTCTTGTCAGATGTCAAGCCCTTCCTCATTGCCATTCCTGCCATTATTGCC
TTGGCCACTGTTGTCATGGTATTTATTGCCTGGAAGCTCTACCAAGAATTTGCCTGGGATATTCTCAAGAATATC
GGCGCAGATTATCGCATGAAGAAGCGCTTCCTTGACTACCAGATTTACATTGCCCTGCTTAAATTCGACTTCTTC
TTCTTTCTCGGCTTCATTATCCAATTCGTCGTTATTGTCGCTCAAAAGACGGACCCCGAGTTTGCTCTGACTATT
GCCACTATACCCATCACCATCATCATCCTGCTCCTTGCCGCCTACTTTACGCGTAGGGAGAGCAAGTGGGGAATG
ATTGCCGTTATTATTCTCTACTTTGGCGGTCTCACCTACTTCATCTTCAAACTTGTCCGCATCTACGACCCCAAG
ACTCGAGACGAATACATGGCTGTTCGCAAGTCTCTGACTGCCTTTGCCGTTATTACCATTCTCTTGATCATTCTC
ACCATTGCCAATGCCATTATTTGCATGCGCAACTTTAATAATGGCCTCAAGATGCATTTGCAGTCGCCGCGAAGA
GAGGAGGAGAAGCCAGACATGCACTCGATTAGCCTGCACGACGTTAAGCCTCAACTACCTAGTCGCATGACGATT
GACTAG
Gene >OphauB2|1820
ATGCATCGCGACACCATGGGTTTCCTCCACTCCAAATGGCCTGCTGCCTTTATGGCTGTCACGGGCGTCCAGGCC
CTAATATGTCTGGGTTTTGAGTCGTGAGTTGTGCGCGCCTCTTTGCCACTGTCCTCCCCGACTTATATCCCTCTC
CTTCTAGTTATGTCTTTGCCAAGTTTCAGACGAGCCTGGCCTCGAAACAACTCTCAACCGACTCCATGGTGCAGT
CGCAGTACAAGACAATTCCCACCTTTTTGACTCTCTTTATATTCGGCTTCCTCTACGAACTCGTCGTTGTCTGGG
ACGCCCTGCGCATGAAGAATACCATTCAAGTCATTGGCGTCTGCATCGCCAACCTCGCTCTCTTGGTCTACACGG
CCATTCAAGTCGATCAGATCCAGGCGGCAATCTTCGTCTTGGCTTCCCGCGGTGCCCTCAAGCGCCAGTTCACCG
CCGACGACGTCTTGTCAGATGTCAAGCCCTTCCTCATTGCCATTCCTGCCATTATTGCCTTGGCCACTGTTGTCA
TGGTATTTATTGCCTGGAAGCTCTACCAAGAATTTGCCTGGGATATTCTCAAGAATATCGGCGCAGATTATCGCA
TGAAGAAGCGCTTCCTTGACTACCAGGTGGGCCTCGACTTTTTTCTATTTTGCCTACACACTTGTGCTAATACCT
CCTTTTTCCGCCAGATTTACATTGCCCTGCTTAAATTCGACTTCTTCTTCTTTCTCGGCTTCATTATCCAATTCG
TCGTTATTGTCGCTCAAAAGACGGACCCCGAGTTTGCTCTGACTATTGCCACTATACCCATCACCATCATCATCC
TGCTCCTTGCCGCCTACTTTACGCGTAGGGAGAGCAAGTGGGGAATGATTGCCGTTATTATTCTCTACTTTGGCG
GTCTCACCTACTTCATCTTCAAACTTGTCCGCATCTACGACCCCAAGACTCGAGACGAATACATGGCTGTTCGCA
AGTCTCTGACTGCCTTTGCCGTTATTACCATTCTCTTGATCATTCTCACCATTGCCAATGCCATTATTTGCATGC
GCAACTTTAATAATGGCCTCAAGATGCATTTGCAGTCGCCGCGAAGAGAGGAGGAGAAGCCAGACATGCACTCGA
TTAGCCTGCACGACGTTAAGCCTCAACTACCTAGTCGCATGACGATTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail