Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1816
Gene name
LocationContig_150:40870..43483
Strand+
Gene length (bp)2613
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07971 Glyco_hydro_92 Glycosyl hydrolase family 92 5.7E-133 277 759
PF17678 Glyco_hydro_92N Glycosyl hydrolase family 92 N-terminal domain 4.1E-56 24 271

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ATR3|A7629_ARTBC Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07629 PE=1 SV=1 9 775 0.0E+00
sp|O86365|Y584_MYCTU Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0584 PE=3 SV=1 18 776 8.0E-43

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1816
MRALGSANVLGVLLAAVVADPLAHVRPLIGSSNGGNVFAGATLPYGLAKAVADVDGENTGGFAMDGSNVTGFSTV
HDSGTGGNPSLGNFPIFPQLCPGDDLNQCKFSIDERKVKYKMATVMAEPGMFSLELQNGIQANMTVSQHAALFRF
RFPDKVSKEMGAVRPLILLDLTDLWKSRQIASVSVDETTGRIMGNGTFLPSFGAGQYTMHFCLDFDDAKIYETGV
WANGRAGANTKDMVLPRGFNKFYNEGGGFVRFIPHHEVVSARMGISYKSADQACHHAETEIADIANGFDGLVAHA
REQWRRKLGPISISPGLLPDMDLIKSFWSGVYRTMISPQNYTGENPHWDTGKPYFDSFYCIWDSFRTQHPFLTLV
DPNAQTQMVQSLLDIYEHEGWLPDCHMSMCQGWTQGGSNADVVLADGYVKNLSTAIDWKLALEAMRKDAEVEPFE
WSQHGRGNVRSWHEHGFIPYQDFDPVGFGTNSRSISRTLEYSYNDFCIATVAAGLQEPKELVDGYMSSSMNWRRL
WRSTQTSKVRKKDTGFMGFLQPKFTNETWGFQDPAYCSTVSGTFCSLTSNPSETFEASIWQYIFYTPHVMSTLIS
FVGGDNNFVDRLNFFHTSGLADISNEPVFLTVFLYHYAGRPGLSARRVTTYLPSFTAKPDGLPGNDDSGAMGSFL
VFCAMGLFPVAGQDVYLITPPLFEEVRIKSPVTGKTATIRNIGHDRKLTKRFVTTATLNGADYKKSWVPHRFFTE
GWTLELQLGEQESDWGRAPMDRPPSWAVQD*
Coding >OphauB2|1816
ATGCGAGCCCTCGGCAGCGCCAATGTGCTCGGCGTGCTCCTCGCGGCCGTCGTAGCTGATCCTCTTGCGCACGTC
AGGCCCTTGATCGGATCCTCCAATGGAGGCAATGTCTTTGCTGGCGCCACGCTGCCCTATGGGCTGGCCAAGGCG
GTGGCCGATGTCGACGGCGAGAACACGGGCGGCTTTGCCATGGACGGCAGCAACGTGACGGGCTTCTCCACCGTC
CATGACAGTGGCACCGGCGGCAATCCCAGCCTGGGCAACTTTCCCATCTTTCCCCAGCTCTGCCCTGGCGACGAC
CTGAACCAGTGCAAGTTTTCCATTGACGAGCGCAAGGTCAAGTACAAAATGGCCACCGTCATGGCCGAGCCGGGC
ATGTTTAGCCTTGAGCTGCAAAACGGCATCCAAGCCAACATGACGGTGTCGCAGCACGCCGCGCTCTTTCGCTTC
CGCTTCCCCGACAAGGTGTCCAAGGAGATGGGCGCTGTGCGTCCGCTCATCCTGCTTGACCTGACGGACCTGTGG
AAGAGCAGGCAAATCGCCTCGGTCAGCGTCGACGAGACGACGGGCCGCATCATGGGCAACGGCACCTTTTTGCCC
AGCTTTGGCGCCGGCCAGTACACGATGCACTTTTGCCTCGACTTTGACGACGCCAAGATTTACGAGACGGGCGTC
TGGGCCAATGGTCGCGCCGGTGCAAACACAAAGGACATGGTGCTGCCCCGGGGCTTCAACAAGTTTTACAATGAG
GGCGGCGGCTTTGTGCGCTTCATCCCCCATCACGAAGTCGTCTCGGCTCGCATGGGCATCAGCTACAAGAGCGCC
GACCAGGCCTGCCACCACGCCGAGACGGAGATTGCAGACATTGCCAATGGCTTTGATGGGCTTGTTGCCCATGCA
AGAGAGCAGTGGCGGCGCAAGCTGGGTCCCATTTCCATTTCCCCGGGCCTTTTGCCCGACATGGATCTCATCAAG
AGCTTTTGGAGCGGTGTCTATCGGACCATGATTTCGCCGCAAAACTACACGGGCGAGAACCCGCACTGGGATACG
GGGAAGCCCTACTTTGACTCGTTTTACTGCATCTGGGATAGTTTTCGAACACAGCACCCCTTTCTCACCCTAGTG
GACCCCAATGCCCAGACGCAAATGGTGCAGTCGCTGCTGGACATTTACGAGCACGAGGGCTGGCTGCCCGACTGC
CACATGTCCATGTGCCAGGGATGGACGCAAGGAGGCTCCAACGCCGACGTGGTGCTGGCGGACGGCTATGTAAAG
AATCTGAGCACGGCGATTGACTGGAAACTCGCCCTCGAGGCCATGCGAAAGGACGCCGAGGTGGAGCCGTTTGAG
TGGTCGCAGCACGGGCGCGGCAACGTCAGGAGCTGGCACGAGCACGGCTTTATTCCCTACCAAGACTTTGACCCT
GTGGGCTTTGGCACCAACTCGCGCAGCATCTCGCGCACGCTCGAGTATTCGTATAATGACTTTTGCATTGCCACG
GTGGCGGCGGGCTTGCAGGAGCCCAAGGAGCTGGTTGATGGGTACATGAGCAGCAGTATGAATTGGCGGCGGCTG
TGGAGGTCGACGCAGACGTCCAAGGTGCGCAAGAAGGATACGGGCTTTATGGGCTTTTTGCAGCCCAAGTTTACA
AATGAGACGTGGGGGTTCCAGGACCCGGCGTATTGCTCGACTGTGTCGGGCACTTTTTGCTCTCTGACGAGTAAC
CCGAGCGAGACGTTTGAGGCGAGCATCTGGCAGTACATCTTCTACACGCCTCACGTCATGTCGACCCTCATTTCC
TTTGTCGGCGGCGACAACAACTTTGTAGACCGCCTCAACTTTTTCCACACGAGCGGGCTGGCCGACATTTCCAAC
GAGCCCGTCTTCCTCACCGTCTTTCTCTACCACTATGCCGGACGGCCCGGCCTCTCTGCCCGGCGCGTCACGACA
TATCTGCCCTCGTTTACGGCCAAGCCCGACGGCCTCCCCGGCAACGACGACTCTGGCGCCATGGGGTCCTTTCTC
GTCTTTTGCGCCATGGGGCTCTTTCCCGTGGCGGGACAAGACGTTTATTTGATTACGCCGCCGCTCTTTGAGGAG
GTGCGCATCAAGAGTCCTGTTACGGGCAAGACGGCAACGATTCGCAACATTGGCCATGATAGGAAGCTGACGAAG
CGCTTTGTGACGACGGCGACGCTGAATGGGGCGGATTATAAAAAGTCGTGGGTGCCGCATCGCTTCTTTACCGAG
GGGTGGACGCTGGAGCTGCAGCTGGGTGAGCAGGAGAGTGATTGGGGTAGGGCGCCCATGGATAGGCCGCCGAGT
TGGGCGGTGCAGGATTGA
Transcript >OphauB2|1816
ATGCGAGCCCTCGGCAGCGCCAATGTGCTCGGCGTGCTCCTCGCGGCCGTCGTAGCTGATCCTCTTGCGCACGTC
AGGCCCTTGATCGGATCCTCCAATGGAGGCAATGTCTTTGCTGGCGCCACGCTGCCCTATGGGCTGGCCAAGGCG
GTGGCCGATGTCGACGGCGAGAACACGGGCGGCTTTGCCATGGACGGCAGCAACGTGACGGGCTTCTCCACCGTC
CATGACAGTGGCACCGGCGGCAATCCCAGCCTGGGCAACTTTCCCATCTTTCCCCAGCTCTGCCCTGGCGACGAC
CTGAACCAGTGCAAGTTTTCCATTGACGAGCGCAAGGTCAAGTACAAAATGGCCACCGTCATGGCCGAGCCGGGC
ATGTTTAGCCTTGAGCTGCAAAACGGCATCCAAGCCAACATGACGGTGTCGCAGCACGCCGCGCTCTTTCGCTTC
CGCTTCCCCGACAAGGTGTCCAAGGAGATGGGCGCTGTGCGTCCGCTCATCCTGCTTGACCTGACGGACCTGTGG
AAGAGCAGGCAAATCGCCTCGGTCAGCGTCGACGAGACGACGGGCCGCATCATGGGCAACGGCACCTTTTTGCCC
AGCTTTGGCGCCGGCCAGTACACGATGCACTTTTGCCTCGACTTTGACGACGCCAAGATTTACGAGACGGGCGTC
TGGGCCAATGGTCGCGCCGGTGCAAACACAAAGGACATGGTGCTGCCCCGGGGCTTCAACAAGTTTTACAATGAG
GGCGGCGGCTTTGTGCGCTTCATCCCCCATCACGAAGTCGTCTCGGCTCGCATGGGCATCAGCTACAAGAGCGCC
GACCAGGCCTGCCACCACGCCGAGACGGAGATTGCAGACATTGCCAATGGCTTTGATGGGCTTGTTGCCCATGCA
AGAGAGCAGTGGCGGCGCAAGCTGGGTCCCATTTCCATTTCCCCGGGCCTTTTGCCCGACATGGATCTCATCAAG
AGCTTTTGGAGCGGTGTCTATCGGACCATGATTTCGCCGCAAAACTACACGGGCGAGAACCCGCACTGGGATACG
GGGAAGCCCTACTTTGACTCGTTTTACTGCATCTGGGATAGTTTTCGAACACAGCACCCCTTTCTCACCCTAGTG
GACCCCAATGCCCAGACGCAAATGGTGCAGTCGCTGCTGGACATTTACGAGCACGAGGGCTGGCTGCCCGACTGC
CACATGTCCATGTGCCAGGGATGGACGCAAGGAGGCTCCAACGCCGACGTGGTGCTGGCGGACGGCTATGTAAAG
AATCTGAGCACGGCGATTGACTGGAAACTCGCCCTCGAGGCCATGCGAAAGGACGCCGAGGTGGAGCCGTTTGAG
TGGTCGCAGCACGGGCGCGGCAACGTCAGGAGCTGGCACGAGCACGGCTTTATTCCCTACCAAGACTTTGACCCT
GTGGGCTTTGGCACCAACTCGCGCAGCATCTCGCGCACGCTCGAGTATTCGTATAATGACTTTTGCATTGCCACG
GTGGCGGCGGGCTTGCAGGAGCCCAAGGAGCTGGTTGATGGGTACATGAGCAGCAGTATGAATTGGCGGCGGCTG
TGGAGGTCGACGCAGACGTCCAAGGTGCGCAAGAAGGATACGGGCTTTATGGGCTTTTTGCAGCCCAAGTTTACA
AATGAGACGTGGGGGTTCCAGGACCCGGCGTATTGCTCGACTGTGTCGGGCACTTTTTGCTCTCTGACGAGTAAC
CCGAGCGAGACGTTTGAGGCGAGCATCTGGCAGTACATCTTCTACACGCCTCACGTCATGTCGACCCTCATTTCC
TTTGTCGGCGGCGACAACAACTTTGTAGACCGCCTCAACTTTTTCCACACGAGCGGGCTGGCCGACATTTCCAAC
GAGCCCGTCTTCCTCACCGTCTTTCTCTACCACTATGCCGGACGGCCCGGCCTCTCTGCCCGGCGCGTCACGACA
TATCTGCCCTCGTTTACGGCCAAGCCCGACGGCCTCCCCGGCAACGACGACTCTGGCGCCATGGGGTCCTTTCTC
GTCTTTTGCGCCATGGGGCTCTTTCCCGTGGCGGGACAAGACGTTTATTTGATTACGCCGCCGCTCTTTGAGGAG
GTGCGCATCAAGAGTCCTGTTACGGGCAAGACGGCAACGATTCGCAACATTGGCCATGATAGGAAGCTGACGAAG
CGCTTTGTGACGACGGCGACGCTGAATGGGGCGGATTATAAAAAGTCGTGGGTGCCGCATCGCTTCTTTACCGAG
GGGTGGACGCTGGAGCTGCAGCTGGGTGAGCAGGAGAGTGATTGGGGTAGGGCGCCCATGGATAGGCCGCCGAGT
TGGGCGGTGCAGGATTGA
Gene >OphauB2|1816
ATGCGAGCCCTCGGCAGCGCCAATGTGCTCGGCGTGCTCCTCGCGGCCGTCGTAGCTGATCCTCTTGCGCACGTC
AGGCCCTTGATCGGATCCTCCAATGGAGGCAATGTCTTTGCTGGCGCCACGCTGCCCTATGGGCTGGCCAAGGCG
GTGGCCGATGTCGACGGCGAGAACACGGGCGGCTTTGCCATGGACGGCAGCAACGTGACGGGCTTCTCCACCGTC
CATGACAGTGGCACCGGCGGCAATCCCAGCCTGGGCAACTTTCCCATCTTTCCCCAGCTCTGCCCTGGCGACGAC
CTGAACCAGTGCAAGTTTTCCATTGACGAGCGCAAGGTCAAGTACAAAATGGCCACCGTCATGGCCGAGCCGGGC
ATGTTTAGCCTTGAGCTGCAAAACGGCATCCAAGCCAACATGACGGTGTCGCAGCACGCCGCGCTCTTTCGCTTC
CGCTTCCCCGACAAGGTGTCCAAGGAGATGGGCGCTGTGCGTCCGCTCATCCTGCTTGACCTGACGGACCTGTGG
AAGAGCAGGCAAATCGCCTCGGTCAGCGTCGACGAGACGACGGGCCGCATCATGGGCAACGGCACCTTTTTGCCC
AGCTTTGGCGCCGGCCAGTACACGATGCACTTTTGCCTCGACTTTGACGACGCCAAGATTTACGAGACGGGCGTC
TGGGCCAATGGTCGCGCCGGTGCAAACACAAAGGACATGGTGCTGCCCCGGGGCTTCAACAAGTTTTACAATGAG
GGCGGCGGCTTTGTGCGCTTCATCCCCCATCACGAAGTCGTCTCGGCTCGCATGGGCATCAGCTACAAGAGCGCC
GACCAGGCCTGCCACCACGCCGAGACGGAGATTGCAGACATTGCCAATGGCTTTGATGGGCTTGTTGCCCATGCA
AGAGAGCAGTGGCGGCGCAAGCTGGGTCCCATTTCCATTTCCCCGGGCCTTTTGCCCGACATGGATCTCATCAAG
AGCTTTTGGAGCGGTGTCTATCGGACCATGATTTCGCCGCAAAACTACACGGGCGAGAACCCGCACTGGGATACG
GGGAAGCCCTACTTTGACTCGTTTTACTGGTATGTGTTTTTGTCTGTTTTGTTTTCTCTTGTCGGCGCCTTGTTT
ATTTCATCTTGATTTTTTTTTTAACATCTTGAGCTATATATTATACTGCAACTTGGTATAAACTACATTTTATAT
TACTCGTGGGTGGGGAAAGGGGAGCTGCACTTGTGGACTTGCTGGCTGACGTCGAGGTTAGCATCTGGGATAGTT
TTCGAACACAGCACCCCTTTCTCACCCTAGTGGACCCCAATGCCCAGACGCAAATGGTGCAGTCGCTGCTGGACA
TTTACGAGCACGAGGGCTGGCTGCCCGACTGCCACATGTCCATGTGCCAGGGATGGACGCAAGGAGGCTCCAACG
CCGACGTGGTGCTGGCGGACGGCTATGTAAAGAATCTGAGCACGGCGATTGACTGGAAACTCGCCCTCGAGGCCA
TGCGAAAGGACGCCGAGGTGGAGCCGTTTGAGTGGTCGCAGCACGGGCGCGGCAACGTCAGGAGCTGGCACGAGC
ACGGCTTTATTCCCTACCAAGACTTTGACCCTGTGGGCTTTGGCACCAACTCGCGCAGCATCTCGCGCACGCTCG
AGTATTCGTATAATGACTTTTGCATTGCCACGGTGGCGGCGGGCTTGCAGGAGCCCAAGGAGCTGGTTGATGGGT
ACATGAGCAGCAGTATGAATTGGCGGCGGCTGTGGAGGTCGACGCAGACGTCCAAGGTGCGCAAGAAGGATACGG
GCTTTATGGGCTTTTTGCAGCCCAAGTTTACAAATGAGACGTGGGGGTTCCAGGACCCGGCGTATTGCTCGACTG
TGTCGGGCACTTTTTGCTCTCTGACGAGTAACCCGAGCGAGACGTTTGAGGCGAGCATCTGGCAGTACATCTTGT
ACGTTTTGCTCTCGTGTCCCTTTTTTCTTGTCTCATCATGCTGCCTGCCTCTAGTGTTTGCTTCAAGCTGACTGG
GCACTTTACAGCTACACGCCTCACGTCATGTCGACCCTCATTTCCTTTGTCGGCGGCGACAACAACTTTGTAGAC
CGCCTCAACTTTTTCCACACGAGCGGGCTGGCCGACATTTCCAACGAGCCCGTCTTCCTCACCGTCTTTCTCTAC
CACTATGCCGGACGGCCCGGCCTCTCTGCCCGGCGCGTCACGACATATCTGCCCTCGTTTACGGCCAAGCCCGAC
GGCCTCCCCGGCAACGACGACTCTGGCGCCATGGGGTCCTTTCTCGTCTTTTGCGCCATGGGGCTCTTTCCCGTG
GCGGGACAAGACGTTTATTTGATTACGCCGCCGCTCTTTGAGGAGGTGCGCATCAAGAGTCCTGTTACGGGCAAG
ACGGCAACGATTCGCAACATTGGCCATGATAGGAAGCTGACGAAGCGCTTTGTGACGACGGCGACGCTGAATGGG
GCGGATTATAAAAAGTCGTGGGTGCCGCATCGCTTCTTTACCGAGGGGTGGACGCTGGAGCTGCAGCTGGGTGAG
CAGGAGAGTGATTGGGGTAGGGCGCCCATGGATAGGCCGCCGAGTTGGGCGGTGCAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail