Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1814
Gene name
LocationContig_150:35161..36571
Strand-
Gene length (bp)1410
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 9.2E-43 65 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 20 274 5.0E-77
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 22 284 7.0E-70
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 1 282 3.0E-65
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 10 296 1.0E-59
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 2 285 2.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 20 274 5.0E-77
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 22 284 7.0E-70
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 1 282 3.0E-65
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 10 296 1.0E-59
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 2 285 2.0E-57
sp|Q5AK54|CRH12_CANAL Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH12 PE=1 SV=1 26 259 3.0E-41
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 21 274 1.0E-31
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 84 233 5.0E-28
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 84 249 2.0E-26
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 84 238 3.0E-20
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 55 262 3.0E-17
sp|Q38911|XTH15_ARATH Xyloglucan endotransglucosylase/hydrolase protein 15 OS=Arabidopsis thaliana GN=XTH15 PE=1 SV=1 64 242 1.0E-14
sp|Q9M0D1|XTH19_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 19 OS=Arabidopsis thaliana GN=XTH19 PE=2 SV=1 84 243 1.0E-14
sp|Q9ZV40|XTH21_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 21 OS=Arabidopsis thaliana GN=XTH21 PE=2 SV=1 45 235 3.0E-14
sp|Q38910|XTH23_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 23 OS=Arabidopsis thaliana GN=XTH23 PE=2 SV=1 45 242 7.0E-14
sp|Q9FI31|XTH20_ARATH Xyloglucan endotransglucosylase/hydrolase protein 20 OS=Arabidopsis thaliana GN=XTH20 PE=2 SV=1 56 243 8.0E-14
sp|P24806|XTH24_ARATH Xyloglucan endotransglucosylase/hydrolase protein 24 OS=Arabidopsis thaliana GN=XTH24 PE=1 SV=2 64 243 9.0E-14
sp|O80803|XTH17_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 17 OS=Arabidopsis thaliana GN=XTH17 PE=1 SV=1 84 243 1.0E-13
sp|Q38857|XTH22_ARATH Xyloglucan endotransglucosylase/hydrolase protein 22 OS=Arabidopsis thaliana GN=XTH22 PE=1 SV=1 45 239 1.0E-13
sp|Q9M0D2|XTH18_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 18 OS=Arabidopsis thaliana GN=XTH18 PE=2 SV=1 84 243 1.0E-13
sp|Q9ZSU4|XTH14_ARATH Xyloglucan endotransglucosylase/hydrolase protein 14 OS=Arabidopsis thaliana GN=XTH14 PE=1 SV=1 84 242 3.0E-13
sp|Q8LG58|XTH16_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 16 OS=Arabidopsis thaliana GN=XTH16 PE=2 SV=2 70 242 7.0E-13
sp|P35694|XTH2_SOYBN Xyloglucan endotransglucosylase/hydrolase 2 OS=Glycine max PE=2 SV=1 70 246 1.0E-12
sp|Q9FKL9|XTH12_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 12 OS=Arabidopsis thaliana GN=XTH12 PE=2 SV=1 84 245 1.0E-12
sp|Q38907|XTH25_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 25 OS=Arabidopsis thaliana GN=XTH25 PE=2 SV=2 69 241 2.0E-12
sp|Q8LF99|XTH6_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2 67 243 3.0E-12
sp|Q9FKL8|XTH13_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 13 OS=Arabidopsis thaliana GN=XTH13 PE=3 SV=1 84 245 1.0E-11
sp|P93046|XTH31_ARATH Xyloglucan endotransglucosylase/hydrolase protein 31 OS=Arabidopsis thaliana GN=XTH31 PE=1 SV=2 91 243 2.0E-11
sp|Q41638|XTHA_PHAAN Xyloglucan endotransglucosylase/hydrolase protein A OS=Phaseolus angularis GN=XTHA PE=1 SV=1 64 243 2.0E-11
sp|Q8LER3|XTH7_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana GN=XTH7 PE=2 SV=2 88 243 6.0E-11
sp|Q8L7H3|XTH29_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 29 OS=Arabidopsis thaliana GN=XTH29 PE=2 SV=1 117 243 4.0E-10
sp|Q38909|XTH28_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 28 OS=Arabidopsis thaliana GN=XTH28 PE=2 SV=1 106 235 6.0E-10
sp|Q9SV60|XTH2_ARATH Xyloglucan endotransglucosylase/hydrolase protein 2 OS=Arabidopsis thaliana GN=XTH2 PE=2 SV=1 106 242 7.0E-10
sp|Q9ZVK1|XTH10_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 10 OS=Arabidopsis thaliana GN=XTH10 PE=2 SV=1 90 255 8.0E-10
sp|Q9SVV2|XTH26_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 26 OS=Arabidopsis thaliana GN=XTH26 PE=2 SV=1 44 235 8.0E-10
sp|Q38908|XTH30_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 30 OS=Arabidopsis thaliana GN=XTH30 PE=2 SV=2 119 243 1.0E-09
sp|Q8LDW9|XTH9_ARATH Xyloglucan endotransglucosylase/hydrolase protein 9 OS=Arabidopsis thaliana GN=XTH9 PE=2 SV=2 88 243 1.0E-09
sp|Q8L9A9|XTH8_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 8 OS=Arabidopsis thaliana GN=XTH8 PE=2 SV=2 69 250 1.0E-09
sp|P37073|GUB_BREBE Beta-glucanase OS=Brevibacillus brevis GN=bglBB PE=1 SV=1 76 208 2.0E-09
sp|Q39857|XTH1_SOYBN Xyloglucan endotransglucosylase/hydrolase 1 OS=Glycine max GN=XTH1 PE=2 SV=2 92 243 3.0E-09
sp|Q8LDS2|XTH27_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 27 OS=Arabidopsis thaliana GN=XTH27 PE=2 SV=2 106 243 5.0E-09
sp|Q9SV61|XTH1_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 1 OS=Arabidopsis thaliana GN=XTH1 PE=3 SV=2 92 234 5.0E-08
sp|Q39099|XTH4_ARATH Xyloglucan endotransglucosylase/hydrolase protein 4 OS=Arabidopsis thaliana GN=XTH4 PE=1 SV=1 92 243 1.0E-07
sp|P27051|GUB_BACLI Beta-glucanase OS=Bacillus licheniformis GN=bg1 PE=1 SV=1 92 208 2.0E-07
sp|P93349|XTH_TOBAC Probable xyloglucan endotransglucosylase/hydrolase protein OS=Nicotiana tabacum GN=XTH PE=2 SV=1 64 243 4.0E-07
sp|Q9SJL9|XTH32_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 32 OS=Arabidopsis thaliana GN=XTH32 PE=2 SV=1 91 241 7.0E-07
sp|Q76BW5|XTH8_ORYSJ Xyloglucan endotransglycosylase/hydrolase protein 8 OS=Oryza sativa subsp. japonica GN=XTH8 PE=1 SV=1 91 242 1.0E-06
sp|Q6YDN9|XTH_BRAOB Xyloglucan endotransglucosylase/hydrolase OS=Brassica oleracea var. botrytis GN=XET16A PE=1 SV=1 92 243 2.0E-06
sp|P45797|GUB_PAEPO Beta-glucanase OS=Paenibacillus polymyxa GN=gluB PE=3 SV=1 92 237 2.0E-06
sp|Q40144|XTH1_SOLLC Probable xyloglucan endotransglucosylase/hydrolase 1 OS=Solanum lycopersicum GN=XTH1 PE=2 SV=1 84 243 4.0E-06
sp|Q9XIW1|XTH5_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 5 OS=Arabidopsis thaliana GN=XTH5 PE=2 SV=1 64 243 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1814
MLSKPFSAATLALAASSLVSAQTFSECNPTKKTCPPNPALGSKVDCDFTKGDCGFFGKAVGTDIKHNGNGAEFSI
SQDSDAPTIRGNKYIFFGRVDVEAQAAPGRGIVTSVVLLSDDLDEIDWEWLGGDAGHVQTNYFSKGDTSVYDRSA
SHPVAAATTQFHKYSIEWTSSAIVWSIDGQPVRTLASDAAKGGAAFPQTPMQVKLGTWVAGRKDAPEGTVTWAGG
RADYSQSPFVGYYKSISIVDYAGKDKPANGGIKEYVYGDQSGSKQSIKIVPGNSDDAVKDRTSSKDGKDDDDDKF
SNTKSVEMPPPGRASTTSNEPSASLPAATSAAATSAATPASTPAASNKADTAVAGLPSTSSPRPAPLSTLAASAS
GTASRVPALSDRLPTSAATSSTNPATLPGSAAAPRHAASLSAALIAFAALLL*
Coding >OphauB2|1814
ATGCTCTCCAAGCCCTTTTCAGCCGCCACTCTGGCTTTGGCTGCCTCGTCGCTTGTTTCGGCACAAACCTTTTCA
GAGTGCAACCCGACCAAGAAGACATGTCCCCCCAACCCTGCTCTGGGCTCCAAGGTGGACTGCGACTTTACAAAG
GGCGACTGTGGCTTTTTTGGCAAAGCCGTTGGCACCGACATCAAGCACAATGGCAATGGAGCCGAGTTTTCCATT
TCCCAAGACTCTGACGCGCCCACCATTCGCGGCAACAAGTACATCTTTTTTGGCCGCGTCGACGTGGAAGCCCAA
GCAGCCCCCGGTCGAGGCATCGTGACCAGTGTGGTCTTGTTGTCAGATGACTTGGACGAGATTGACTGGGAATGG
CTCGGCGGAGATGCTGGCCACGTGCAGACCAACTACTTTAGCAAGGGCGACACCAGCGTATACGACCGCAGCGCG
AGCCACCCTGTTGCTGCTGCCACGACGCAGTTCCACAAGTACTCGATTGAATGGACCTCGTCGGCCATTGTCTGG
TCCATTGACGGCCAGCCCGTGCGCACCCTGGCCTCGGACGCGGCCAAGGGTGGCGCTGCCTTTCCTCAGACGCCC
ATGCAGGTCAAGCTGGGCACCTGGGTCGCTGGCCGAAAAGACGCCCCCGAGGGCACCGTGACTTGGGCTGGCGGC
CGCGCCGACTACTCCCAATCCCCCTTTGTCGGCTACTACAAGAGCATCTCCATTGTCGACTATGCCGGCAAGGAC
AAGCCTGCCAATGGCGGCATCAAGGAGTACGTCTATGGCGACCAGTCTGGCTCCAAGCAGAGCATCAAGATTGTC
CCGGGAAACAGCGACGACGCCGTCAAGGACCGCACCTCGTCCAAGGACGGCAAGGACGACGACGACGACAAGTTT
AGCAACACCAAGTCGGTCGAGATGCCGCCGCCTGGCCGCGCCTCGACTACCTCTAATGAGCCTTCTGCCTCTTTG
CCTGCTGCCACTTCTGCCGCCGCCACTTCTGCCGCCACGCCTGCCTCCACCCCCGCCGCCTCCAACAAGGCCGAC
ACTGCAGTCGCTGGCTTGCCCTCGACTAGCTCTCCCCGCCCCGCGCCTCTGTCCACCCTGGCTGCCTCTGCCTCG
GGCACCGCTTCCAGAGTCCCGGCCCTGTCTGACCGTCTGCCAACCTCGGCTGCCACGTCGTCCACCAACCCCGCT
ACTCTTCCCGGCTCTGCCGCTGCGCCTCGTCACGCTGCCAGCCTGAGTGCTGCCTTGATTGCTTTTGCCGCCTTG
CTCTTGTAA
Transcript >OphauB2|1814
ATGCTCTCCAAGCCCTTTTCAGCCGCCACTCTGGCTTTGGCTGCCTCGTCGCTTGTTTCGGCACAAACCTTTTCA
GAGTGCAACCCGACCAAGAAGACATGTCCCCCCAACCCTGCTCTGGGCTCCAAGGTGGACTGCGACTTTACAAAG
GGCGACTGTGGCTTTTTTGGCAAAGCCGTTGGCACCGACATCAAGCACAATGGCAATGGAGCCGAGTTTTCCATT
TCCCAAGACTCTGACGCGCCCACCATTCGCGGCAACAAGTACATCTTTTTTGGCCGCGTCGACGTGGAAGCCCAA
GCAGCCCCCGGTCGAGGCATCGTGACCAGTGTGGTCTTGTTGTCAGATGACTTGGACGAGATTGACTGGGAATGG
CTCGGCGGAGATGCTGGCCACGTGCAGACCAACTACTTTAGCAAGGGCGACACCAGCGTATACGACCGCAGCGCG
AGCCACCCTGTTGCTGCTGCCACGACGCAGTTCCACAAGTACTCGATTGAATGGACCTCGTCGGCCATTGTCTGG
TCCATTGACGGCCAGCCCGTGCGCACCCTGGCCTCGGACGCGGCCAAGGGTGGCGCTGCCTTTCCTCAGACGCCC
ATGCAGGTCAAGCTGGGCACCTGGGTCGCTGGCCGAAAAGACGCCCCCGAGGGCACCGTGACTTGGGCTGGCGGC
CGCGCCGACTACTCCCAATCCCCCTTTGTCGGCTACTACAAGAGCATCTCCATTGTCGACTATGCCGGCAAGGAC
AAGCCTGCCAATGGCGGCATCAAGGAGTACGTCTATGGCGACCAGTCTGGCTCCAAGCAGAGCATCAAGATTGTC
CCGGGAAACAGCGACGACGCCGTCAAGGACCGCACCTCGTCCAAGGACGGCAAGGACGACGACGACGACAAGTTT
AGCAACACCAAGTCGGTCGAGATGCCGCCGCCTGGCCGCGCCTCGACTACCTCTAATGAGCCTTCTGCCTCTTTG
CCTGCTGCCACTTCTGCCGCCGCCACTTCTGCCGCCACGCCTGCCTCCACCCCCGCCGCCTCCAACAAGGCCGAC
ACTGCAGTCGCTGGCTTGCCCTCGACTAGCTCTCCCCGCCCCGCGCCTCTGTCCACCCTGGCTGCCTCTGCCTCG
GGCACCGCTTCCAGAGTCCCGGCCCTGTCTGACCGTCTGCCAACCTCGGCTGCCACGTCGTCCACCAACCCCGCT
ACTCTTCCCGGCTCTGCCGCTGCGCCTCGTCACGCTGCCAGCCTGAGTGCTGCCTTGATTGCTTTTGCCGCCTTG
CTCTTGTAA
Gene >OphauB2|1814
ATGCTCTCCAAGCCCTTTTCAGCCGCCACTCTGGCTTTGGCTGCCTCGTCGCTTGTTTCGGCACAAACCTTTTCA
GAGTGCAACCCGACCAAGAAGAGTAAGTCGTGCAAGCCACCATTTGCGGCCTCGGCACAGGTCTACTGACCACTA
CAACTACACAGCATGTCCCCCCAACCCTGCTCTGGGCTCCAAGGTGGACTGCGACTTTACAAAGGGCGACTGTGG
CTTTTTTGGCAAAGCCGTTGGCACCGACATCAAGCACAATGGCAATGGAGCCGAGTTTTCCATTTCCCAAGACTC
TGACGCGCCCACCATTCGCGGCAACAAGTACATCTTTTTTGGCCGCGTCGACGTGGAAGCCCAAGCAGCCCCCGG
TCGAGGCATCGTGACCAGTGTGGTCTTGTTGTCAGATGACTTGGACGAGGTTGGTTGGCGCCTGTCTTGTTGCAA
AATTTGCAAAGCCGTCGAGACTAACAGCAGCTCCAGATTGACTGGGAATGGCTCGGCGGAGATGCTGGCCACGTG
CAGACCAACTACTTTAGCAAGGGCGACACCAGCGTATACGACCGCAGCGCGAGCCACCCTGTTGCTGCTGCCACG
ACGCAGTTCCACAAGTACTCGATTGAATGGACCTCGTCGGCCATTGTCTGGTCCATTGACGGCCAGCCCGTGCGC
ACCCTGGCCTCGGACGCGGCCAAGGGTGGCGCTGCCTTTCCTCAGACGCCCATGCAGGTCAAGCTGGGCACCTGG
GTCGCTGGCCGAAAAGACGCCCCCGAGGGCACCGTGACTTGGGCTGGCGGCCGCGCCGACTACTCCCAATCCCCC
TTTGTCGGCTACTACAAGAGCATCTCCATTGTCGACTATGCCGGCAAGGACAAGCCTGCCAATGGCGGCATCAAG
GAGTACGTCTATGGCGACCAGTCTGGCTCCAAGCAGAGCATCAAGATTGTCCCGGGAAACAGCGACGACGCCGTC
AAGGACCGCACCTCGTCCAAGGACGGCAAGGACGACGACGACGACAAGTTTAGCAACACCAAGTCGGTCGAGATG
CCGCCGCCTGGCCGCGCCTCGACTACCTCTAATGAGCCTTCTGCCTCTTTGCCTGCTGCCACTTCTGCCGCCGCC
ACTTCTGCCGCCACGCCTGCCTCCACCCCCGCCGCCTCCAACAAGGCCGACACTGCAGTCGCTGGCTTGCCCTCG
ACTAGCTCTCCCCGCCCCGCGCCTCTGTCCACCCTGGCTGCCTCTGCCTCGGGCACCGCTTCCAGAGTCCCGGCC
CTGTCTGACCGTCTGCCAACCTCGGCTGCCACGTCGTCCACCAACCCCGCTACTCTTCCCGGCTCTGCCGCTGCG
CCTCGTCACGCTGCCAGCCTGAGTGCTGCCTTGATTGCTTTTGCCGCCTTGCTCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail