Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|180
Gene name
LocationContig_10:53230..54899
Strand-
Gene length (bp)1669
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02076 STE3 Pheromone A receptor 4.2E-60 40 332

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P06783|STE3_YEAST Pheromone a factor receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE3 PE=1 SV=1 36 361 1.0E-12
sp|P31303|PRA2_USTMD Pheromone receptor 2 OS=Ustilago maydis GN=PRA2 PE=3 SV=1 114 333 4.0E-07
sp|P31397|MAP3_SCHPO Pheromone M-factor receptor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=map3 PE=2 SV=1 78 325 9.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0004932 mating-type factor pheromone receptor activity Yes
GO:0005575 cellular_component No
GO:0008528 G protein-coupled peptide receptor activity No
GO:0016503 pheromone receptor activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0001653 peptide receptor activity No
GO:0038023 signaling receptor activity No
GO:0031224 intrinsic component of membrane No
GO:0004888 transmembrane signaling receptor activity No
GO:0007165 signal transduction No
GO:0050789 regulation of biological process No
GO:0110165 cellular anatomical entity No
GO:0065007 biological regulation No
GO:0004930 G protein-coupled receptor activity No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No
GO:0060089 molecular transducer activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 61 83 22
3 103 125 22
4 149 171 22
5 191 213 22
6 244 266 22
7 301 323 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|180
MNQSTTISSFMQDTALVFRAPSPSYTPRGVTANLVARVSLSLVANVICLVPLRLLHRNGEFAAAVFVATVELLNL
ETIVLSLTWRNDDVDSFWPGYGLCDVDGFFHNAATSLYATCLLAIVRNLAQQVGMMRASPLSCREKKWRNIKQAL
VMFPLPIVQLAMTWPVTSQRFQVGTLVGCSWIPHPSWPNLVFFVLPLVVVGVVTAGYAVLTYYRYRQISKSTQPA
ISSDRSALRRSQRTKRRLYLMVISILVPYLPVVIAFGVINILNKHGLLPYDYYQMHRRILPTPWNTIALYPSSDV
PWLDTNVCYINILSSVSIFLFFGTTKDAMNQYRCVFLALGLARLFPRLNEVYDPDSSSRTASSFASSYTTVMGKC
KTSKYGSYSSSGRWPSIHTLSTTEPRDQHFVMPATDLERGPGPDAAHRRNPFPWRTTLSLTVPFSLAWLLSRRPS
NKSSTPLQASGSKAPLSRQDVPASTPP*
Coding >OphauB2|180
ATGAACCAGTCAACGACAATCTCGTCCTTTATGCAAGACACGGCCCTCGTTTTCAGAGCACCGAGCCCGTCATAC
ACGCCGCGCGGCGTAACCGCCAACCTCGTGGCCCGCGTGAGCCTCTCCCTCGTGGCCAACGTTATTTGCCTGGTG
CCGCTGCGTCTGCTACACCGCAACGGAGAATTCGCCGCCGCCGTCTTTGTCGCCACGGTCGAGCTGCTCAATCTG
GAAACCATTGTCTTGTCGCTGACGTGGCGCAACGACGACGTGGACTCGTTTTGGCCGGGCTACGGCCTCTGTGAT
GTGGATGGCTTCTTCCACAATGCCGCCACGAGCCTCTACGCGACTTGTCTGCTCGCCATTGTGCGCAACCTGGCG
CAGCAGGTGGGCATGATGCGTGCCAGTCCGCTGTCTTGCCGCGAGAAGAAGTGGCGCAATATCAAGCAGGCGCTC
GTCATGTTTCCCCTGCCCATTGTCCAGCTTGCCATGACGTGGCCTGTGACGAGCCAGCGCTTCCAGGTTGGCACA
CTTGTTGGATGCAGCTGGATTCCGCATCCCTCGTGGCCAAATCTGGTGTTTTTTGTTTTGCCTCTAGTTGTCGTG
GGTGTCGTTACGGCGGGATATGCAGTTCTCACCTATTACCGATACCGCCAAATTTCCAAATCAACCCAGCCCGCC
ATCTCAAGCGACCGCTCAGCCCTTCGCAGGAGCCAGCGCACCAAGCGCCGACTCTACCTCATGGTTATATCCATC
CTGGTGCCCTATCTGCCCGTTGTTATTGCCTTTGGCGTCATCAACATCCTGAACAAGCACGGCCTCTTGCCCTAC
GACTACTACCAGATGCACCGTCGCATTCTCCCCACGCCGTGGAACACTATTGCGCTGTACCCGTCTTCTGATGTC
CCGTGGCTGGATACAAATGTCTGCTACATCAATATACTCAGCTCCGTCTCCATCTTTCTCTTTTTTGGGACGACC
AAGGATGCCATGAATCAGTATAGATGTGTATTTCTTGCTCTGGGGCTTGCGAGGCTGTTTCCGCGGCTCAACGAG
GTGTATGACCCAGACTCGTCGTCTAGGACTGCGAGTTCCTTTGCTTCAAGCTACACGACGGTCATGGGTAAATGC
AAAACGAGCAAGTACGGCTCCTACTCTTCATCAGGCCGCTGGCCGAGCATCCATACCCTGTCAACCACTGAGCCT
CGAGACCAACATTTTGTCATGCCAGCCACTGATTTAGAGCGCGGCCCCGGACCCGATGCAGCCCACCGCCGCAAC
CCGTTTCCCTGGCGCACCACGCTCTCCTTGACAGTCCCCTTTAGCCTCGCTTGGCTGCTCTCAAGACGCCCGTCC
AACAAGTCGAGCACGCCACTGCAAGCATCTGGGTCCAAGGCGCCCCTGTCCCGGCAAGATGTACCTGCCAGCACA
CCACCTTGA
Transcript >OphauB2|180
ATGAACCAGTCAACGACAATCTCGTCCTTTATGCAAGACACGGCCCTCGTTTTCAGAGCACCGAGCCCGTCATAC
ACGCCGCGCGGCGTAACCGCCAACCTCGTGGCCCGCGTGAGCCTCTCCCTCGTGGCCAACGTTATTTGCCTGGTG
CCGCTGCGTCTGCTACACCGCAACGGAGAATTCGCCGCCGCCGTCTTTGTCGCCACGGTCGAGCTGCTCAATCTG
GAAACCATTGTCTTGTCGCTGACGTGGCGCAACGACGACGTGGACTCGTTTTGGCCGGGCTACGGCCTCTGTGAT
GTGGATGGCTTCTTCCACAATGCCGCCACGAGCCTCTACGCGACTTGTCTGCTCGCCATTGTGCGCAACCTGGCG
CAGCAGGTGGGCATGATGCGTGCCAGTCCGCTGTCTTGCCGCGAGAAGAAGTGGCGCAATATCAAGCAGGCGCTC
GTCATGTTTCCCCTGCCCATTGTCCAGCTTGCCATGACGTGGCCTGTGACGAGCCAGCGCTTCCAGGTTGGCACA
CTTGTTGGATGCAGCTGGATTCCGCATCCCTCGTGGCCAAATCTGGTGTTTTTTGTTTTGCCTCTAGTTGTCGTG
GGTGTCGTTACGGCGGGATATGCAGTTCTCACCTATTACCGATACCGCCAAATTTCCAAATCAACCCAGCCCGCC
ATCTCAAGCGACCGCTCAGCCCTTCGCAGGAGCCAGCGCACCAAGCGCCGACTCTACCTCATGGTTATATCCATC
CTGGTGCCCTATCTGCCCGTTGTTATTGCCTTTGGCGTCATCAACATCCTGAACAAGCACGGCCTCTTGCCCTAC
GACTACTACCAGATGCACCGTCGCATTCTCCCCACGCCGTGGAACACTATTGCGCTGTACCCGTCTTCTGATGTC
CCGTGGCTGGATACAAATGTCTGCTACATCAATATACTCAGCTCCGTCTCCATCTTTCTCTTTTTTGGGACGACC
AAGGATGCCATGAATCAGTATAGATGTGTATTTCTTGCTCTGGGGCTTGCGAGGCTGTTTCCGCGGCTCAACGAG
GTGTATGACCCAGACTCGTCGTCTAGGACTGCGAGTTCCTTTGCTTCAAGCTACACGACGGTCATGGGTAAATGC
AAAACGAGCAAGTACGGCTCCTACTCTTCATCAGGCCGCTGGCCGAGCATCCATACCCTGTCAACCACTGAGCCT
CGAGACCAACATTTTGTCATGCCAGCCACTGATTTAGAGCGCGGCCCCGGACCCGATGCAGCCCACCGCCGCAAC
CCGTTTCCCTGGCGCACCACGCTCTCCTTGACAGTCCCCTTTAGCCTCGCTTGGCTGCTCTCAAGACGCCCGTCC
AACAAGTCGAGCACGCCACTGCAAGCATCTGGGTCCAAGGCGCCCCTGTCCCGGCAAGATGTACCTGCCAGCACA
CCACCTTGA
Gene >OphauB2|180
ATGAACCAGTCAACGACAATCTCGTCCTTTATGCAAGACACGGCCCTCGTTTTCAGAGCACCGAGCCCGTCATAC
ACGCCGCGCGGCGTAACCGCCAACCTCGTGGCCCGCGTGAGCCTCTCCCTCGTGGCCAACGTTATTTGCCTGGTG
CCGCTGCGTCTGCTACACCGCAACGGAGAATTCGCCGCCGCCGTCTTTGTCGCCACGGTCGAGCTGCTCAATCTG
GAAACCATTGTCTTGTCGCTGACGTGGCGCAACGACGACGTGGACTCGTTTTGGCCGGGCTACGGCCTCTGTGAT
GTGGATGGCTTCTTCCACAATGCCGCCACGAGCCTCTACGCGACTTGTCTGCTCGCCATTGTGCGCAACCTGGCG
CAGCAGGTGGGCATGATGCGTGCCAGTCCGCTGTCTTGCCGCGAGAAGAAGTGGCGCAATATCAAGCAGGCGCTC
GTCATGTTTCCCCTGCCCATTGTCCAGCTTGCCATGACGTGGCCTGTGACGAGCCAGCGCTTCCAGGTTGGCACA
CTTGTTGGATGCAGCTGGATTCCGCATCCCTCGTGGCCAAATCTGGTGTTTTTTGTTTTGCCTCTAGTTGTCGTG
GGTGTCGTTACGGCGGGATATGCAGGTCAGTCGTTGTTCTTAATCAAGCCGTCTCTCATCTCTTGTCTTGTCTTG
GTAGCATCGTCTGCTGGCATCTCTTGTTGGCGTCGTTTGTTTGATTTAGACTGCTCGCAAATATCACCAAAACAA
GCGACTTTGAAGCTCAAGAAGCAACTAACTCGACACTTTGTACTCTAGTTCTCACCTATTACCGATACCGCCAAA
TTTCCAAATCAACCCAGCCCGCCATCTCAAGCGACCGCTCAGCCCTTCGCAGGAGCCAGCGCACCAAGCGCCGAC
TCTACCTCATGGTTATATCCATCCTGGTGCCCTATCTGCCCGTTGTTATTGCCTTTGGCGTCATCAACATCCTGA
ACAAGCACGGCCTCTTGCCCTACGACTACTACCAGATGCACCGTCGCATTCTCCCCACGCCGTGGAACACTATTG
CGCTGTACCCGTCTTCTGATGTCCCGTGGCTGGATACAAATGTCTGCTACATCAATATACTCAGCTCCGTCTCCA
TCTTTCTCTTTTTTGGGACGACCAAGGATGCCATGAATCAGTATAGATGTGTATTTCTTGCTCTGGGGCTTGCGA
GGCTGTTTCCGCGGCTCAACGAGGTGTATGACCCAGACTCGTCGTCTAGGACTGCGAGTTCCTTTGCTTCAAGCT
ACACGACGGTCATGGGGTAAGTATAGATGAAACCAGCATCTTTGCATGTCGTCATGCGCAAGCTAACACGGATAC
AAGTAAATGCAAAACGAGCAAGTACGGCTCCTACTCTTCATCAGGCCGCTGGCCGAGCATCCATACCCTGTCAAC
CACTGAGCCTCGAGACCAACATTTTGTCATGCCAGCCACTGATTTAGAGCGCGGCCCCGGACCCGATGCAGCCCA
CCGCCGCAACCCGTTTCCCTGGCGCACCACGCTCTCCTTGACAGTCCCCTTTAGCCTCGCTTGGCTGCTCTCAAG
ACGCCCGTCCAACAAGTCGAGCACGCCACTGCAAGCATCTGGGTCCAAGGCGCCCCTGTCCCGGCAAGATGTACC
TGCCAGCACACCACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail