Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|18
Gene name
LocationContig_1:46957..50137
Strand-
Gene length (bp)3180
Transcript length (bp)3129
Coding sequence length (bp)3129
Protein length (aa) 1043

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03810 IBN_N Importin-beta N-terminal domain 4.3E-15 37 110

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02932|KA120_YEAST Importin beta-like protein KAP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP120 PE=1 SV=1 11 786 2.0E-93
sp|Q9UI26|IPO11_HUMAN Importin-11 OS=Homo sapiens GN=IPO11 PE=1 SV=1 22 771 1.0E-82
sp|Q8K2V6|IPO11_MOUSE Importin-11 OS=Mus musculus GN=Ipo11 PE=1 SV=1 22 771 2.0E-82
sp|O94545|KA113_SCHPO Importin beta-like protein kap113 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap113 PE=3 SV=1 23 1035 2.0E-71
sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens GN=IPO7 PE=1 SV=1 21 171 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02932|KA120_YEAST Importin beta-like protein KAP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP120 PE=1 SV=1 11 786 2.0E-93
sp|Q9UI26|IPO11_HUMAN Importin-11 OS=Homo sapiens GN=IPO11 PE=1 SV=1 22 771 1.0E-82
sp|Q8K2V6|IPO11_MOUSE Importin-11 OS=Mus musculus GN=Ipo11 PE=1 SV=1 22 771 2.0E-82
sp|O94545|KA113_SCHPO Importin beta-like protein kap113 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap113 PE=3 SV=1 23 1035 2.0E-71
sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens GN=IPO7 PE=1 SV=1 21 171 1.0E-07
sp|Q9EPL8|IPO7_MOUSE Importin-7 OS=Mus musculus GN=Ipo7 PE=1 SV=2 21 171 1.0E-06
sp|F4J738|SAD2H_ARATH Importin beta-like SAD2 homolog OS=Arabidopsis thaliana GN=At3g59020 PE=1 SV=1 25 166 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031267 small GTPase binding Yes
GO:0006886 intracellular protein transport Yes
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0019899 enzyme binding No
GO:0051179 localization No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0051020 GTPase binding No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|18
MSFAIEVSGDANPLTAEGLCTVLESATSTNPVQRQAATGQLTAWEQQPGYYSSLQTVYLSKSLPLQVRFLAVIQL
KNGIDKNWRLYSTIKNSISPDEKKLIRSRLFQGTIDEPERSLALHNALVAAKVIRIDYPKDWPSAFSEIIGFMRS
TRGTNQRHLHGTLLVLLRVVKELCTARLKRSQTSLQSVTPELVYILSEIYSEQSNLWLSFLSARRTNDDNISLSL
LNSLLALKLLRRLIIVGYARPHTDQSVDKFWALTQNQFGHFLSLVDSDGDMPHNYDDLIGKHLLQFTKFHIEMAD
QNVASFATLPNSLSLVHAYWNLIDRFSQSFTQSGGIRQESGASGTNKAKILGPLPERLALKGLLLLRACARAAFQ
RIATLKYRTPEVKAEQEAAQKIIKNELFKDEFVLQVVNVIITHFFVFRRSDLQAWEEDAEEWEQQEQSEGNAWEW
EVRPCAEKLFLDLLINFRQLLIPPLLDYFKTAQDPQAEIDRKEAAYTTLGLAAAHVCEVFDFDSLLTSTLVQDSQ
RQGNLQKVLRRRIAILISQWAPVKMTNESRPLVYQIYEHFLNPGDDNNDLVVRITTARQLRWIADELGFNIEAFL
PFAPNIFMQLIETVQGLELDETKLAILESLRILVMRLENHVSQFGDQLMSTLPKLWETTGSDEYMIKQAIIAIIA
ALVTSMGEEAKRYHSFIIPLLSEAARPNSDLHMHLIDESLELWNNILVQSSAPLAPGLMGLAHMAIPLLGYPTET
ASQALSAIEAYIVMDPAAMLEDGLRRPILAALSDCLDSKSRDQVCVGTICIEYMIRAATDLGGSTGISVVMQDMI
AIGMLEKMMRQLREVWESGQASGPEKKSHELNVASEGDFFAILARLALADPHIFMQGLGALGNQQEIWEWLSNEW
FLYVSNADHAERLKLYMLALTRFIELGSPMKELVLGRLQDYFNMWANVIMELQDGVVDGTDSLIWGELEASEYDT
AKIVAERRMTERDPVHSVHALGFVEPRLQDLVTRAGGEAVFQEQWAVNVDRDVLAKYEELAKSMRKT*
Coding >OphauB2|18
ATGAGCTTCGCCATCGAAGTATCGGGCGACGCAAACCCTCTGACAGCCGAGGGCCTCTGTACCGTTTTGGAGTCG
GCCACGTCGACGAATCCCGTACAGCGTCAGGCAGCCACAGGCCAACTCACAGCCTGGGAGCAACAGCCAGGCTAC
TACTCATCGTTACAGACAGTTTACTTGAGCAAGTCCCTGCCCTTGCAAGTGCGCTTCCTCGCCGTCATACAACTC
AAAAATGGAATCGACAAGAACTGGCGGCTATACTCGACCATCAAGAATAGTATATCTCCCGACGAGAAGAAGCTC
ATCCGATCACGCCTCTTCCAAGGAACCATTGACGAACCCGAGCGAAGCCTGGCTCTACATAATGCCCTGGTGGCG
GCCAAGGTCATCCGTATCGACTATCCAAAGGACTGGCCAAGTGCTTTTTCAGAAATTATTGGTTTCATGCGGTCC
ACCAGAGGCACCAACCAAAGACACTTGCATGGCACATTGCTCGTGCTCCTTCGAGTCGTCAAGGAGCTTTGTACG
GCTCGCCTGAAACGCTCGCAGACATCGCTACAATCAGTCACGCCCGAGCTGGTCTATATTCTCAGCGAAATTTAC
TCTGAGCAGTCCAACTTATGGCTCTCCTTCTTGTCAGCTCGTCGCACCAACGACGACAATATCAGTCTGTCTCTG
CTTAACAGCTTACTGGCGCTGAAGCTTCTTCGGCGCTTGATCATTGTTGGCTATGCTCGGCCTCATACCGACCAA
TCTGTTGACAAGTTTTGGGCCTTGACGCAGAACCAATTCGGGCACTTCTTGTCCCTGGTCGATTCTGACGGCGAC
ATGCCACACAACTACGACGACTTGATTGGAAAACACCTTCTTCAATTCACCAAGTTCCATATTGAAATGGCGGAT
CAAAATGTTGCCAGCTTTGCCACTCTTCCCAACTCGCTGTCCTTGGTTCATGCCTACTGGAATTTAATCGACAGG
TTTTCCCAATCTTTCACCCAGTCTGGTGGCATTCGGCAAGAGTCCGGTGCCTCTGGTACGAACAAGGCCAAGATT
TTGGGCCCTCTTCCCGAGAGATTGGCGCTCAAGGGCCTTCTTTTGCTTCGTGCCTGTGCTAGAGCTGCTTTCCAG
CGCATAGCGACTTTGAAGTATAGGACTCCTGAAGTCAAGGCTGAGCAGGAAGCAGCCCAAAAAATCATCAAAAAC
GAGCTCTTCAAGGACGAATTTGTCCTGCAAGTTGTCAATGTCATTATTACTCATTTTTTTGTCTTTCGGCGATCA
GACTTGCAAGCCTGGGAAGAAGATGCTGAGGAATGGGAACAGCAGGAACAGAGCGAGGGTAATGCATGGGAATGG
GAAGTGCGACCTTGCGCCGAGAAGCTCTTTTTAGATCTTCTTATAAACTTTAGGCAGCTTCTCATCCCCCCTCTT
CTCGATTATTTTAAAACTGCCCAAGATCCCCAGGCCGAGATTGACAGAAAAGAGGCGGCATACACGACCCTGGGC
TTGGCAGCGGCGCACGTGTGTGAAGTGTTTGATTTTGACTCTTTACTAACGTCGACACTTGTGCAAGATTCTCAG
AGACAAGGCAACCTCCAAAAGGTGCTTCGGCGAAGAATTGCTATTCTCATTAGCCAGTGGGCGCCGGTCAAAATG
ACGAATGAAAGCCGACCACTTGTATACCAGATCTATGAGCATTTTTTGAACCCTGGAGACGACAATAATGACTTG
GTGGTTAGAATCACGACTGCAAGACAACTTCGCTGGATTGCCGACGAGTTGGGATTCAACATTGAGGCATTTCTT
CCGTTTGCGCCAAACATTTTTATGCAACTCATTGAGACAGTGCAAGGCCTTGAACTCGATGAGACCAAGCTGGCG
ATACTTGAGTCTCTTCGAATATTGGTGATGCGGCTGGAGAACCATGTATCACAATTTGGCGACCAGCTCATGTCG
ACTCTGCCAAAGCTATGGGAGACGACTGGATCCGACGAATATATGATCAAGCAAGCCATTATTGCTATTATTGCG
GCTTTGGTTACAAGTATGGGTGAAGAGGCAAAACGCTACCACAGCTTTATTATCCCCCTGCTCTCAGAAGCCGCC
AGACCCAACTCTGATTTGCACATGCATCTTATTGACGAGTCACTTGAGCTGTGGAACAACATTTTGGTGCAGAGC
AGTGCCCCACTGGCTCCAGGTCTCATGGGGCTGGCACACATGGCGATTCCGCTTCTTGGATACCCAACCGAGACG
GCTTCACAGGCGCTGTCTGCTATTGAAGCGTACATAGTGATGGATCCAGCTGCTATGCTCGAAGACGGACTACGC
CGCCCCATACTGGCGGCTCTTTCGGACTGTTTGGATTCGAAAAGCCGAGACCAGGTGTGCGTGGGCACTATCTGC
ATTGAGTACATGATTCGAGCCGCGACCGACCTGGGGGGGTCTACCGGCATCTCGGTGGTGATGCAAGACATGATT
GCCATTGGGATGCTTGAAAAGATGATGCGCCAACTGCGAGAAGTGTGGGAGTCTGGACAGGCGTCGGGGCCAGAA
AAGAAGAGTCATGAGCTCAATGTGGCTTCCGAGGGCGATTTTTTTGCCATTTTGGCTCGCCTGGCTCTGGCCGAT
CCCCACATCTTCATGCAAGGCTTGGGTGCGTTGGGAAACCAGCAAGAGATTTGGGAGTGGCTGAGCAATGAATGG
TTTCTCTATGTTTCCAATGCGGACCACGCGGAACGACTCAAACTATACATGCTTGCCTTGACGAGGTTTATCGAG
TTGGGGTCGCCCATGAAGGAGCTCGTCTTGGGTAGGCTGCAAGACTACTTCAACATGTGGGCAAATGTCATTATG
GAGCTGCAGGATGGAGTTGTCGACGGGACAGATTCGTTGATATGGGGTGAGCTGGAAGCAAGCGAGTATGATACA
GCCAAGATTGTGGCTGAGCGACGCATGACGGAGCGAGATCCGGTTCATTCAGTACACGCCTTGGGCTTTGTTGAG
CCCAGGCTCCAGGACCTAGTGACGCGAGCAGGAGGCGAAGCAGTGTTTCAAGAGCAATGGGCCGTCAATGTGGAC
AGGGACGTGCTGGCCAAGTATGAGGAGCTTGCCAAGTCGATGCGGAAGACGTAG
Transcript >OphauB2|18
ATGAGCTTCGCCATCGAAGTATCGGGCGACGCAAACCCTCTGACAGCCGAGGGCCTCTGTACCGTTTTGGAGTCG
GCCACGTCGACGAATCCCGTACAGCGTCAGGCAGCCACAGGCCAACTCACAGCCTGGGAGCAACAGCCAGGCTAC
TACTCATCGTTACAGACAGTTTACTTGAGCAAGTCCCTGCCCTTGCAAGTGCGCTTCCTCGCCGTCATACAACTC
AAAAATGGAATCGACAAGAACTGGCGGCTATACTCGACCATCAAGAATAGTATATCTCCCGACGAGAAGAAGCTC
ATCCGATCACGCCTCTTCCAAGGAACCATTGACGAACCCGAGCGAAGCCTGGCTCTACATAATGCCCTGGTGGCG
GCCAAGGTCATCCGTATCGACTATCCAAAGGACTGGCCAAGTGCTTTTTCAGAAATTATTGGTTTCATGCGGTCC
ACCAGAGGCACCAACCAAAGACACTTGCATGGCACATTGCTCGTGCTCCTTCGAGTCGTCAAGGAGCTTTGTACG
GCTCGCCTGAAACGCTCGCAGACATCGCTACAATCAGTCACGCCCGAGCTGGTCTATATTCTCAGCGAAATTTAC
TCTGAGCAGTCCAACTTATGGCTCTCCTTCTTGTCAGCTCGTCGCACCAACGACGACAATATCAGTCTGTCTCTG
CTTAACAGCTTACTGGCGCTGAAGCTTCTTCGGCGCTTGATCATTGTTGGCTATGCTCGGCCTCATACCGACCAA
TCTGTTGACAAGTTTTGGGCCTTGACGCAGAACCAATTCGGGCACTTCTTGTCCCTGGTCGATTCTGACGGCGAC
ATGCCACACAACTACGACGACTTGATTGGAAAACACCTTCTTCAATTCACCAAGTTCCATATTGAAATGGCGGAT
CAAAATGTTGCCAGCTTTGCCACTCTTCCCAACTCGCTGTCCTTGGTTCATGCCTACTGGAATTTAATCGACAGG
TTTTCCCAATCTTTCACCCAGTCTGGTGGCATTCGGCAAGAGTCCGGTGCCTCTGGTACGAACAAGGCCAAGATT
TTGGGCCCTCTTCCCGAGAGATTGGCGCTCAAGGGCCTTCTTTTGCTTCGTGCCTGTGCTAGAGCTGCTTTCCAG
CGCATAGCGACTTTGAAGTATAGGACTCCTGAAGTCAAGGCTGAGCAGGAAGCAGCCCAAAAAATCATCAAAAAC
GAGCTCTTCAAGGACGAATTTGTCCTGCAAGTTGTCAATGTCATTATTACTCATTTTTTTGTCTTTCGGCGATCA
GACTTGCAAGCCTGGGAAGAAGATGCTGAGGAATGGGAACAGCAGGAACAGAGCGAGGGTAATGCATGGGAATGG
GAAGTGCGACCTTGCGCCGAGAAGCTCTTTTTAGATCTTCTTATAAACTTTAGGCAGCTTCTCATCCCCCCTCTT
CTCGATTATTTTAAAACTGCCCAAGATCCCCAGGCCGAGATTGACAGAAAAGAGGCGGCATACACGACCCTGGGC
TTGGCAGCGGCGCACGTGTGTGAAGTGTTTGATTTTGACTCTTTACTAACGTCGACACTTGTGCAAGATTCTCAG
AGACAAGGCAACCTCCAAAAGGTGCTTCGGCGAAGAATTGCTATTCTCATTAGCCAGTGGGCGCCGGTCAAAATG
ACGAATGAAAGCCGACCACTTGTATACCAGATCTATGAGCATTTTTTGAACCCTGGAGACGACAATAATGACTTG
GTGGTTAGAATCACGACTGCAAGACAACTTCGCTGGATTGCCGACGAGTTGGGATTCAACATTGAGGCATTTCTT
CCGTTTGCGCCAAACATTTTTATGCAACTCATTGAGACAGTGCAAGGCCTTGAACTCGATGAGACCAAGCTGGCG
ATACTTGAGTCTCTTCGAATATTGGTGATGCGGCTGGAGAACCATGTATCACAATTTGGCGACCAGCTCATGTCG
ACTCTGCCAAAGCTATGGGAGACGACTGGATCCGACGAATATATGATCAAGCAAGCCATTATTGCTATTATTGCG
GCTTTGGTTACAAGTATGGGTGAAGAGGCAAAACGCTACCACAGCTTTATTATCCCCCTGCTCTCAGAAGCCGCC
AGACCCAACTCTGATTTGCACATGCATCTTATTGACGAGTCACTTGAGCTGTGGAACAACATTTTGGTGCAGAGC
AGTGCCCCACTGGCTCCAGGTCTCATGGGGCTGGCACACATGGCGATTCCGCTTCTTGGATACCCAACCGAGACG
GCTTCACAGGCGCTGTCTGCTATTGAAGCGTACATAGTGATGGATCCAGCTGCTATGCTCGAAGACGGACTACGC
CGCCCCATACTGGCGGCTCTTTCGGACTGTTTGGATTCGAAAAGCCGAGACCAGGTGTGCGTGGGCACTATCTGC
ATTGAGTACATGATTCGAGCCGCGACCGACCTGGGGGGGTCTACCGGCATCTCGGTGGTGATGCAAGACATGATT
GCCATTGGGATGCTTGAAAAGATGATGCGCCAACTGCGAGAAGTGTGGGAGTCTGGACAGGCGTCGGGGCCAGAA
AAGAAGAGTCATGAGCTCAATGTGGCTTCCGAGGGCGATTTTTTTGCCATTTTGGCTCGCCTGGCTCTGGCCGAT
CCCCACATCTTCATGCAAGGCTTGGGTGCGTTGGGAAACCAGCAAGAGATTTGGGAGTGGCTGAGCAATGAATGG
TTTCTCTATGTTTCCAATGCGGACCACGCGGAACGACTCAAACTATACATGCTTGCCTTGACGAGGTTTATCGAG
TTGGGGTCGCCCATGAAGGAGCTCGTCTTGGGTAGGCTGCAAGACTACTTCAACATGTGGGCAAATGTCATTATG
GAGCTGCAGGATGGAGTTGTCGACGGGACAGATTCGTTGATATGGGGTGAGCTGGAAGCAAGCGAGTATGATACA
GCCAAGATTGTGGCTGAGCGACGCATGACGGAGCGAGATCCGGTTCATTCAGTACACGCCTTGGGCTTTGTTGAG
CCCAGGCTCCAGGACCTAGTGACGCGAGCAGGAGGCGAAGCAGTGTTTCAAGAGCAATGGGCCGTCAATGTGGAC
AGGGACGTGCTGGCCAAGTATGAGGAGCTTGCCAAGTCGATGCGGAAGACGTAG
Gene >OphauB2|18
ATGAGCTTCGCCATCGAAGTATCGGGCGACGCAAACCCTCTGACAGCCGAGGGCCTCTGTACCGTTTTGGAGTCG
GCCACGTCGACGAATCCCGTACAGCGTCAGGCAGCCACAGGCCAACTCACAGCCTGGGAGCAACAGCCAGGCTAC
TACTCATCGTTACAGGTTGCTTCTCAGAGCCTCACTTGTCTGCCCTTGCACTAACGCTTTTGCCAGACAGTTTAC
TTGAGCAAGTCCCTGCCCTTGCAAGTGCGCTTCCTCGCCGTCATACAACTCAAAAATGGAATCGACAAGAACTGG
CGGCTATACTCGACCATCAAGAATAGTATATCTCCCGACGAGAAGAAGCTCATCCGATCACGCCTCTTCCAAGGA
ACCATTGACGAACCCGAGCGAAGCCTGGCTCTACATAATGCCCTGGTGGCGGCCAAGGTCATCCGTATCGACTAT
CCAAAGGACTGGCCAAGTGCTTTTTCAGAAATTATTGGTTTCATGCGGTCCACCAGAGGCACCAACCAAAGACAC
TTGCATGGCACATTGCTCGTGCTCCTTCGAGTCGTCAAGGAGCTTTGTACGGCTCGCCTGAAACGCTCGCAGACA
TCGCTACAATCAGTCACGCCCGAGCTGGTCTATATTCTCAGCGAAATTTACTCTGAGCAGTCCAACTTATGGCTC
TCCTTCTTGTCAGCTCGTCGCACCAACGACGACAATATCAGTCTGTCTCTGCTTAACAGCTTACTGGCGCTGAAG
CTTCTTCGGCGCTTGATCATTGTTGGCTATGCTCGGCCTCATACCGACCAATCTGTTGACAAGTTTTGGGCCTTG
ACGCAGAACCAATTCGGGCACTTCTTGTCCCTGGTCGATTCTGACGGCGACATGCCACACAACTACGACGACTTG
ATTGGAAAACACCTTCTTCAATTCACCAAGTTCCATATTGAAATGGCGGATCAAAATGTTGCCAGCTTTGCCACT
CTTCCCAACTCGCTGTCCTTGGTTCATGCCTACTGGAATTTAATCGACAGGTTTTCCCAATCTTTCACCCAGTCT
GGTGGCATTCGGCAAGAGTCCGGTGCCTCTGGTACGAACAAGGCCAAGATTTTGGGCCCTCTTCCCGAGAGATTG
GCGCTCAAGGGCCTTCTTTTGCTTCGTGCCTGTGCTAGAGCTGCTTTCCAGCGCATAGCGACTTTGAAGTATAGG
ACTCCTGAAGTCAAGGCTGAGCAGGAAGCAGCCCAAAAAATCATCAAAAACGAGCTCTTCAAGGACGAATTTGTC
CTGCAAGTTGTCAATGTCATTATTACTCATTTTTTTGTCTTTCGGCGATCAGACTTGCAAGCCTGGGAAGAAGAT
GCTGAGGAATGGGAACAGCAGGAACAGAGCGAGGGTAATGCATGGGAATGGGAAGTGCGACCTTGCGCCGAGAAG
CTCTTTTTAGATCTTCTTATAAACTTTAGGCAGCTTCTCATCCCCCCTCTTCTCGATTATTTTAAAACTGCCCAA
GATCCCCAGGCCGAGATTGACAGAAAAGAGGCGGCATACACGACCCTGGGCTTGGCAGCGGCGCACGTGTGTGAA
GTGTTTGATTTTGACTCTTTACTAACGTCGACACTTGTGCAAGATTCTCAGAGACAAGGCAACCTCCAAAAGGTG
CTTCGGCGAAGAATTGCTATTCTCATTAGCCAGTGGGCGCCGGTCAAAATGACGAATGAAAGCCGACCACTTGTA
TACCAGATCTATGAGCATTTTTTGAACCCTGGAGACGACAATAATGACTTGGTGGTTAGAATCACGACTGCAAGA
CAACTTCGCTGGATTGCCGACGAGTTGGGATTCAACATTGAGGCATTTCTTCCGTTTGCGCCAAACATTTTTATG
CAACTCATTGAGACAGTGCAAGGCCTTGAACTCGATGAGACCAAGCTGGCGATACTTGAGTCTCTTCGAATATTG
GTGATGCGGCTGGAGAACCATGTATCACAATTTGGCGACCAGCTCATGTCGACTCTGCCAAAGCTATGGGAGACG
ACTGGATCCGACGAATATATGATCAAGCAAGCCATTATTGCTATTATTGCGGCTTTGGTTACAAGTATGGGTGAA
GAGGCAAAACGCTACCACAGCTTTATTATCCCCCTGCTCTCAGAAGCCGCCAGACCCAACTCTGATTTGCACATG
CATCTTATTGACGAGTCACTTGAGCTGTGGAACAACATTTTGGTGCAGAGCAGTGCCCCACTGGCTCCAGGTCTC
ATGGGGCTGGCACACATGGCGATTCCGCTTCTTGGATACCCAACCGAGACGGCTTCACAGGCGCTGTCTGCTATT
GAAGCGTACATAGTGATGGATCCAGCTGCTATGCTCGAAGACGGACTACGCCGCCCCATACTGGCGGCTCTTTCG
GACTGTTTGGATTCGAAAAGCCGAGACCAGGTGTGCGTGGGCACTATCTGCATTGAGTACATGATTCGAGCCGCG
ACCGACCTGGGGGGGTCTACCGGCATCTCGGTGGTGATGCAAGACATGATTGCCATTGGGATGCTTGAAAAGATG
ATGCGCCAACTGCGAGAAGTGTGGGAGTCTGGACAGGCGTCGGGGCCAGAAAAGAAGAGTCATGAGCTCAATGTG
GCTTCCGAGGGCGATTTTTTTGCCATTTTGGCTCGCCTGGCTCTGGCCGATCCCCACATCTTCATGCAAGGCTTG
GGTGCGTTGGGAAACCAGCAAGAGATTTGGGAGTGGCTGAGCAATGAATGGTTTCTCTATGTTTCCAATGCGGAC
CACGCGGAACGACTCAAACTATACATGCTTGCCTTGACGAGGTTTATCGAGTTGGGGTCGCCCATGAAGGAGCTC
GTCTTGGGTAGGCTGCAAGACTACTTCAACATGTGGGCAAATGTCATTATGGAGCTGCAGGATGGAGTTGTCGAC
GGGACAGATTCGTTGATATGGGGTGAGCTGGAAGCAAGCGAGTATGATACAGCCAAGATTGTGGCTGAGCGACGC
ATGACGGAGCGAGATCCGGTTCATTCAGTACACGCCTTGGGCTTTGTTGAGCCCAGGCTCCAGGACCTAGTGACG
CGAGCAGGAGGCGAAGCAGTGTTTCAAGAGCAATGGGCCGTCAATGTGGACAGGGACGTGCTGGCCAAGTATGAG
GAGCTTGCCAAGTCGATGCGGAAGACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail