Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|179
Gene name
LocationContig_10:48291..52005
Strand+
Gene length (bp)3714
Transcript length (bp)3597
Coding sequence length (bp)3597
Protein length (aa) 1199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13886 DUF4203 Domain of unknown function (DUF4203) 2.9E-53 147 352

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 142 164 22
2 171 193 22
3 198 220 22
4 227 249 22
5 253 272 19
6 279 301 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|179
MFFRATFFGSIVLLALVLELTAARSLNHFVRQDDGAQATPAASASQAISALTTVSVHGSSSSPLASSTASSSAPD
SQASSPASTSSSSSTATSSSSNGGDEASETQSATEAASPTATDMLNGSPLFNATIPAGQLPLAPKLTPGWGVAGV
VMLTTGLIYTLVGIKKQWVHTFFSTAYMTALGIAVLIMYVMSVPVSNAVQGGFVVAVVVSGCLVGAASMFFKELT
EGLGCALGGFCISMWLLCLVPGGLLHPVAAKAIFIAAFTVVGFALYFSRWTRDWALIILISFAGATISVLGIDCF
SRAGLKEFWVYIWNINSELFPLGADTYPVTKGIRVETAGIVIIFLMGIISQIKLWRIVREKRQKRAVERAEGQRT
FDIEEAAVGRQVEEANARDRRQWERVYGDGTIGSSSDSRVSDLGDCSSEKRLQESRSESCKPRSSLEVIEMAHVP
EPDAHDAKFTVRVGVDDISQAPVDDLEEEKATTAVHHSASTRSRHTATSRRVSSQAQTITEAPTVVPLPFSVPVI
KDSDTSQDEEQDGRSSVATFAEDGDALGPPQRHESFYKRLSRGSASLLRSLSQRSGRGGDEVAPTPPTGSSSEEL
VIPRQQYRRDDDNGSLAATVDIDSDSMSGGDVGSLGTPESRRSIEMEAKESSTLPASLAAKTNTSPCKMQSPASS
PAKTILHHSKMQSPASSPAKTNPQGDDDAASVSNTPKHSPRPKSGISIASTRASLTKEKLPASLSKVALSYRTNE
WAKHLSYADVPNDPPDDASSADDDEPAERTAPLDAVELQKTAQDGAPLPAMSIRRSESQASMASFSPTVVSKRAS
KPDLPAAQGLQERESQLFRLSPASQAHQDRESQLFRLSPASQAHQDRESQSSRLASPLRRVSSRPEGLPTSYSAS
SLPQERDLSAKDVTSIEANSRSPASLRTPTRRASSGFQPIVQERRTTMQADAIPEEPAEAARPISVGPSQRSSAI
SGVVSYANPQTLLGQRELLLRNKSQGSLVVAGPGSDSGSGSPRHSLTAYPPSQFPMPDPDDLPLSQRRQIMRQSS
LMSLPGSNPWPAAGPHESSENLPFNSHQPRRSSGLPSSSSREAQLANFRQSVLHDLRAGTPLLATQGRETPFKPT
SLLANRDAEVQRNIEMQRNVLIGQKEAEAQRRERERLDRENADRIFDERMRNGNLIEAHREAMRRMQRAARNQ*
Coding >OphauB2|179
ATGTTTTTTAGGGCCACGTTTTTCGGTTCCATTGTCCTTTTGGCATTGGTGCTTGAGCTTACTGCGGCAAGAAGC
CTTAACCATTTTGTTAGACAGGACGACGGCGCCCAAGCCACTCCCGCTGCCTCGGCCAGCCAAGCCATTTCCGCC
CTGACAACCGTCTCCGTCCATGGCTCCTCCTCTAGCCCCCTGGCCTCGTCGACTGCGAGCAGCTCTGCCCCAGAC
TCGCAGGCTTCCTCGCCTGCATCAACAAGCTCCAGCTCCTCGACGGCAACAAGCAGCTCTAGCAACGGTGGCGAC
GAGGCCTCAGAGACCCAGTCCGCCACCGAGGCAGCATCGCCCACGGCAACCGATATGCTCAATGGCTCGCCCCTC
TTCAATGCCACCATTCCTGCCGGTCAGCTGCCGCTGGCGCCCAAGCTCACGCCCGGATGGGGTGTAGCGGGAGTG
GTGATGCTCACGACCGGTCTCATCTACACGCTGGTGGGCATCAAGAAGCAGTGGGTTCACACATTCTTCTCCACG
GCCTACATGACCGCCCTCGGCATTGCGGTGCTCATCATGTACGTCATGAGCGTTCCAGTCAGCAACGCGGTGCAG
GGCGGCTTTGTTGTGGCCGTGGTGGTCTCGGGGTGTCTGGTGGGCGCCGCTTCCATGTTTTTCAAGGAGCTCACA
GAGGGCCTGGGCTGCGCTCTGGGTGGCTTCTGCATCAGTATGTGGCTGCTGTGTCTTGTGCCGGGCGGCTTACTG
CATCCGGTCGCCGCCAAGGCCATCTTTATCGCCGCCTTTACCGTCGTGGGCTTTGCCCTCTACTTTAGTCGGTGG
ACGCGCGACTGGGCCCTCATTATCCTCATCTCCTTTGCCGGGGCCACCATTTCAGTGCTTGGAATCGACTGCTTT
AGCCGCGCCGGCCTAAAGGAGTTTTGGGTCTACATCTGGAACATCAACAGCGAGCTTTTCCCCTTGGGTGCAGAC
ACATACCCGGTAACAAAGGGCATCCGCGTCGAGACGGCCGGCATTGTTATTATTTTCCTCATGGGCATCATTTCG
CAAATCAAGCTATGGCGGATCGTCAGGGAAAAGCGCCAAAAGAGGGCGGTGGAGCGCGCCGAGGGCCAACGCACC
TTTGACATTGAAGAAGCGGCTGTTGGCCGCCAGGTCGAGGAGGCAAACGCCCGCGACCGTCGCCAGTGGGAGCGC
GTATATGGCGATGGCACCATTGGCAGCTCCAGCGACTCGCGCGTCTCTGATCTCGGCGACTGCTCCAGCGAAAAG
AGATTGCAGGAGAGCCGGAGCGAGTCGTGCAAGCCGCGCTCCTCGCTCGAGGTGATTGAAATGGCCCACGTGCCT
GAGCCAGACGCCCACGACGCCAAGTTTACCGTCAGGGTGGGCGTCGACGATATTTCCCAGGCGCCCGTCGACGAC
TTGGAGGAGGAAAAGGCCACCACGGCCGTCCACCACTCCGCCTCGACGCGCAGCCGCCACACCGCCACCAGCCGC
CGCGTCTCCTCCCAGGCCCAAACCATTACCGAGGCGCCAACCGTGGTGCCTCTCCCCTTTAGCGTGCCCGTCATC
AAGGACAGCGACACCTCTCAAGATGAGGAGCAAGATGGCCGCTCCTCCGTAGCCACCTTTGCCGAGGACGGGGAT
GCGCTGGGCCCGCCTCAGCGCCATGAATCCTTTTACAAGCGCCTCTCGCGCGGGTCGGCCTCGTTGCTGCGCAGT
CTCTCCCAGCGGTCCGGCCGGGGGGGCGACGAGGTGGCTCCCACGCCGCCAACGGGCAGCAGTTCCGAGGAGCTG
GTAATACCGCGGCAGCAGTACAGACGCGACGACGACAATGGATCCTTGGCTGCAACGGTGGACATTGACAGCGAC
AGTATGAGTGGCGGTGATGTTGGGTCGCTGGGGACGCCAGAGTCGCGCAGAAGCATTGAGATGGAGGCCAAGGAG
TCGTCGACATTGCCAGCTTCGTTGGCCGCAAAAACAAACACATCTCCTTGCAAGATGCAATCGCCAGCCTCTTCT
CCGGCAAAAACAATCTTGCACCACTCCAAAATGCAATCGCCAGCTTCCTCTCCGGCAAAAACAAACCCTCAGGGC
GACGACGACGCCGCCTCGGTCAGCAACACCCCCAAACACTCCCCCCGCCCCAAGTCTGGCATCTCCATCGCCTCG
ACGCGCGCCAGCCTCACCAAGGAAAAACTGCCCGCCTCGCTCTCCAAAGTCGCCCTCTCGTACCGCACCAACGAA
TGGGCCAAGCACCTCAGCTACGCCGACGTGCCCAACGACCCCCCAGACGACGCGTCGAGCGCCGACGACGACGAG
CCCGCCGAGCGCACTGCTCCCCTCGATGCCGTGGAGCTGCAAAAGACGGCCCAGGACGGCGCGCCCCTGCCTGCA
ATGTCTATTCGCCGCAGCGAGTCGCAGGCCTCCATGGCCTCCTTTTCGCCCACTGTGGTGTCGAAGCGTGCCTCC
AAGCCAGACTTGCCGGCGGCTCAGGGGCTGCAGGAGAGGGAGAGTCAGCTTTTTCGTCTCTCGCCTGCTTCCCAA
GCCCACCAAGATAGAGAGAGCCAGCTTTTCCGCCTCTCGCCCGCTTCCCAAGCCCACCAAGATAGAGAAAGCCAA
TCCTCCCGCCTCGCCAGCCCGCTGCGCCGCGTCTCCTCTCGTCCCGAGGGCCTGCCCACCTCGTACTCGGCCTCG
TCGCTGCCCCAGGAGCGAGACTTGAGCGCCAAAGACGTCACCTCCATCGAGGCCAACTCGCGCAGCCCCGCGTCG
CTGCGCACCCCCACGCGCAGAGCCTCGTCTGGCTTCCAGCCCATTGTTCAGGAGCGCCGCACCACAATGCAGGCC
GACGCCATTCCCGAAGAGCCAGCCGAAGCCGCCCGCCCCATTTCCGTCGGCCCGTCGCAGCGCTCCTCGGCCATT
TCCGGCGTCGTCTCCTACGCCAATCCGCAAACCCTCCTCGGCCAGCGCGAACTCCTCCTCCGCAACAAGTCCCAG
GGCAGCCTCGTCGTTGCCGGCCCGGGCAGCGACTCTGGCTCCGGCTCTCCCCGCCACTCCCTAACGGCTTATCCG
CCCTCCCAATTCCCCATGCCCGACCCAGACGACCTGCCCCTCAGCCAGCGCCGCCAAATCATGCGTCAGAGCAGC
CTCATGTCCCTCCCTGGCTCCAACCCCTGGCCCGCTGCCGGCCCCCACGAAAGCTCTGAAAACTTGCCCTTCAAC
TCCCACCAGCCTCGCCGCTCCTCGGGTCTCCCTTCTTCCTCCTCGCGCGAAGCCCAACTGGCAAACTTTCGCCAA
TCCGTCCTCCACGACTTGCGCGCTGGAACTCCCCTCCTCGCTACCCAGGGCCGCGAAACTCCCTTCAAACCAACC
TCCCTCCTCGCCAACCGCGACGCAGAGGTGCAGCGAAATATTGAAATGCAGCGCAACGTCCTCATTGGCCAAAAG
GAGGCCGAGGCCCAGCGCCGTGAGCGCGAGCGCCTCGATAGGGAGAATGCAGATCGCATTTTTGACGAGCGCATG
CGTAATGGCAACTTGATTGAAGCTCACCGCGAGGCTATGCGCAGGATGCAGCGCGCTGCTAGAAATCAGTAG
Transcript >OphauB2|179
ATGTTTTTTAGGGCCACGTTTTTCGGTTCCATTGTCCTTTTGGCATTGGTGCTTGAGCTTACTGCGGCAAGAAGC
CTTAACCATTTTGTTAGACAGGACGACGGCGCCCAAGCCACTCCCGCTGCCTCGGCCAGCCAAGCCATTTCCGCC
CTGACAACCGTCTCCGTCCATGGCTCCTCCTCTAGCCCCCTGGCCTCGTCGACTGCGAGCAGCTCTGCCCCAGAC
TCGCAGGCTTCCTCGCCTGCATCAACAAGCTCCAGCTCCTCGACGGCAACAAGCAGCTCTAGCAACGGTGGCGAC
GAGGCCTCAGAGACCCAGTCCGCCACCGAGGCAGCATCGCCCACGGCAACCGATATGCTCAATGGCTCGCCCCTC
TTCAATGCCACCATTCCTGCCGGTCAGCTGCCGCTGGCGCCCAAGCTCACGCCCGGATGGGGTGTAGCGGGAGTG
GTGATGCTCACGACCGGTCTCATCTACACGCTGGTGGGCATCAAGAAGCAGTGGGTTCACACATTCTTCTCCACG
GCCTACATGACCGCCCTCGGCATTGCGGTGCTCATCATGTACGTCATGAGCGTTCCAGTCAGCAACGCGGTGCAG
GGCGGCTTTGTTGTGGCCGTGGTGGTCTCGGGGTGTCTGGTGGGCGCCGCTTCCATGTTTTTCAAGGAGCTCACA
GAGGGCCTGGGCTGCGCTCTGGGTGGCTTCTGCATCAGTATGTGGCTGCTGTGTCTTGTGCCGGGCGGCTTACTG
CATCCGGTCGCCGCCAAGGCCATCTTTATCGCCGCCTTTACCGTCGTGGGCTTTGCCCTCTACTTTAGTCGGTGG
ACGCGCGACTGGGCCCTCATTATCCTCATCTCCTTTGCCGGGGCCACCATTTCAGTGCTTGGAATCGACTGCTTT
AGCCGCGCCGGCCTAAAGGAGTTTTGGGTCTACATCTGGAACATCAACAGCGAGCTTTTCCCCTTGGGTGCAGAC
ACATACCCGGTAACAAAGGGCATCCGCGTCGAGACGGCCGGCATTGTTATTATTTTCCTCATGGGCATCATTTCG
CAAATCAAGCTATGGCGGATCGTCAGGGAAAAGCGCCAAAAGAGGGCGGTGGAGCGCGCCGAGGGCCAACGCACC
TTTGACATTGAAGAAGCGGCTGTTGGCCGCCAGGTCGAGGAGGCAAACGCCCGCGACCGTCGCCAGTGGGAGCGC
GTATATGGCGATGGCACCATTGGCAGCTCCAGCGACTCGCGCGTCTCTGATCTCGGCGACTGCTCCAGCGAAAAG
AGATTGCAGGAGAGCCGGAGCGAGTCGTGCAAGCCGCGCTCCTCGCTCGAGGTGATTGAAATGGCCCACGTGCCT
GAGCCAGACGCCCACGACGCCAAGTTTACCGTCAGGGTGGGCGTCGACGATATTTCCCAGGCGCCCGTCGACGAC
TTGGAGGAGGAAAAGGCCACCACGGCCGTCCACCACTCCGCCTCGACGCGCAGCCGCCACACCGCCACCAGCCGC
CGCGTCTCCTCCCAGGCCCAAACCATTACCGAGGCGCCAACCGTGGTGCCTCTCCCCTTTAGCGTGCCCGTCATC
AAGGACAGCGACACCTCTCAAGATGAGGAGCAAGATGGCCGCTCCTCCGTAGCCACCTTTGCCGAGGACGGGGAT
GCGCTGGGCCCGCCTCAGCGCCATGAATCCTTTTACAAGCGCCTCTCGCGCGGGTCGGCCTCGTTGCTGCGCAGT
CTCTCCCAGCGGTCCGGCCGGGGGGGCGACGAGGTGGCTCCCACGCCGCCAACGGGCAGCAGTTCCGAGGAGCTG
GTAATACCGCGGCAGCAGTACAGACGCGACGACGACAATGGATCCTTGGCTGCAACGGTGGACATTGACAGCGAC
AGTATGAGTGGCGGTGATGTTGGGTCGCTGGGGACGCCAGAGTCGCGCAGAAGCATTGAGATGGAGGCCAAGGAG
TCGTCGACATTGCCAGCTTCGTTGGCCGCAAAAACAAACACATCTCCTTGCAAGATGCAATCGCCAGCCTCTTCT
CCGGCAAAAACAATCTTGCACCACTCCAAAATGCAATCGCCAGCTTCCTCTCCGGCAAAAACAAACCCTCAGGGC
GACGACGACGCCGCCTCGGTCAGCAACACCCCCAAACACTCCCCCCGCCCCAAGTCTGGCATCTCCATCGCCTCG
ACGCGCGCCAGCCTCACCAAGGAAAAACTGCCCGCCTCGCTCTCCAAAGTCGCCCTCTCGTACCGCACCAACGAA
TGGGCCAAGCACCTCAGCTACGCCGACGTGCCCAACGACCCCCCAGACGACGCGTCGAGCGCCGACGACGACGAG
CCCGCCGAGCGCACTGCTCCCCTCGATGCCGTGGAGCTGCAAAAGACGGCCCAGGACGGCGCGCCCCTGCCTGCA
ATGTCTATTCGCCGCAGCGAGTCGCAGGCCTCCATGGCCTCCTTTTCGCCCACTGTGGTGTCGAAGCGTGCCTCC
AAGCCAGACTTGCCGGCGGCTCAGGGGCTGCAGGAGAGGGAGAGTCAGCTTTTTCGTCTCTCGCCTGCTTCCCAA
GCCCACCAAGATAGAGAGAGCCAGCTTTTCCGCCTCTCGCCCGCTTCCCAAGCCCACCAAGATAGAGAAAGCCAA
TCCTCCCGCCTCGCCAGCCCGCTGCGCCGCGTCTCCTCTCGTCCCGAGGGCCTGCCCACCTCGTACTCGGCCTCG
TCGCTGCCCCAGGAGCGAGACTTGAGCGCCAAAGACGTCACCTCCATCGAGGCCAACTCGCGCAGCCCCGCGTCG
CTGCGCACCCCCACGCGCAGAGCCTCGTCTGGCTTCCAGCCCATTGTTCAGGAGCGCCGCACCACAATGCAGGCC
GACGCCATTCCCGAAGAGCCAGCCGAAGCCGCCCGCCCCATTTCCGTCGGCCCGTCGCAGCGCTCCTCGGCCATT
TCCGGCGTCGTCTCCTACGCCAATCCGCAAACCCTCCTCGGCCAGCGCGAACTCCTCCTCCGCAACAAGTCCCAG
GGCAGCCTCGTCGTTGCCGGCCCGGGCAGCGACTCTGGCTCCGGCTCTCCCCGCCACTCCCTAACGGCTTATCCG
CCCTCCCAATTCCCCATGCCCGACCCAGACGACCTGCCCCTCAGCCAGCGCCGCCAAATCATGCGTCAGAGCAGC
CTCATGTCCCTCCCTGGCTCCAACCCCTGGCCCGCTGCCGGCCCCCACGAAAGCTCTGAAAACTTGCCCTTCAAC
TCCCACCAGCCTCGCCGCTCCTCGGGTCTCCCTTCTTCCTCCTCGCGCGAAGCCCAACTGGCAAACTTTCGCCAA
TCCGTCCTCCACGACTTGCGCGCTGGAACTCCCCTCCTCGCTACCCAGGGCCGCGAAACTCCCTTCAAACCAACC
TCCCTCCTCGCCAACCGCGACGCAGAGGTGCAGCGAAATATTGAAATGCAGCGCAACGTCCTCATTGGCCAAAAG
GAGGCCGAGGCCCAGCGCCGTGAGCGCGAGCGCCTCGATAGGGAGAATGCAGATCGCATTTTTGACGAGCGCATG
CGTAATGGCAACTTGATTGAAGCTCACCGCGAGGCTATGCGCAGGATGCAGCGCGCTGCTAGAAATCAGTAG
Gene >OphauB2|179
ATGTTTTTTAGGGCCACGTTTTTCGGTTCCATTGTCCTTTTGGCATTGGTGCTTGAGCTTACTGCGGCAAGAAGC
CTTAACCATTTTGTTAGACAGGACGACGGCGCCCAAGCCACTCCCGCTGCCTCGGCCAGCCAAGCCATTTCCGCC
CTGACAACCGTCTCCGTCCATGGCTCCTCCTCTAGCCCCCTGGCCTCGTCGACTGCGAGCAGCTCTGCCCCAGAC
TCGCAGGCTTCCTCGCCTGCATCAACAAGCTCCAGCTCCTCGACGGCAACAAGCAGCTCTAGCAACGGTGGCGAC
GAGGCCTCAGAGACCCAGTCCGCCACCGAGGCAGCATCGCCCACGGCAACCGATATGCTCAATGGCTCGCCCCTC
TTCAATGGTATGTTGGAACCTGTCTCGGGCCTTGTTTTCCGTCTGAATGCGGGCCCCCCCCCTTGTCATTGGTGT
TGTTTTTTTTTTTGCTTGCCCTGCTCTAACGCTGCCCTACGACACGCAGCCACCATTCCTGCCGGTCAGCTGCCG
CTGGCGCCCAAGCTCACGCCCGGATGGGGTGTAGCGGGAGTGGTGATGCTCACGACCGGTCTCATCTACACGCTG
GTGGGCATCAAGAAGCAGTGGGTTCACACATTCTTCTCCACGGCCTACATGACCGCCCTCGGCATTGCGGTGCTC
ATCATGTACGTCATGAGCGTTCCAGTCAGCAACGCGGTGCAGGGCGGCTTTGTTGTGGCCGTGGTGGTCTCGGGG
TGTCTGGTGGGCGCCGCTTCCATGTTTTTCAAGGAGCTCACAGAGGGCCTGGGCTGCGCTCTGGGTGGCTTCTGC
ATCAGTATGTGGCTGCTGTGTCTTGTGCCGGGCGGCTTACTGCATCCGGTCGCCGCCAAGGCCATCTTTATCGCC
GCCTTTACCGTCGTGGGCTTTGCCCTCTACTTTAGTCGGTGGACGCGCGACTGGGCCCTCATTATCCTCATCTCC
TTTGCCGGGGCCACCATTTCAGTGCTTGGAATCGACTGCTTTAGCCGCGCCGGCCTAAAGGAGTTTTGGGTCTAC
ATCTGGAACATCAACAGCGAGCTTTTCCCCTTGGGTGCAGACACATACCCGGTAACAAAGGGCATCCGCGTCGAG
ACGGCCGGCATTGTTATTATTTTCCTCATGGGCATCATTTCGCAAATCAAGCTATGGCGGATCGTCAGGGAAAAG
CGCCAAAAGAGGGCGGTGGAGCGCGCCGAGGGCCAACGCACCTTTGACATTGAAGAAGCGGCTGTTGGCCGCCAG
GTCGAGGAGGCAAACGCCCGCGACCGTCGCCAGTGGGAGCGCGTATATGGCGATGGCACCATTGGCAGCTCCAGC
GACTCGCGCGTCTCTGATCTCGGCGACTGCTCCAGCGAAAAGAGATTGCAGGAGAGCCGGAGCGAGTCGTGCAAG
CCGCGCTCCTCGCTCGAGGTGATTGAAATGGCCCACGTGCCTGAGCCAGACGCCCACGACGCCAAGTTTACCGTC
AGGGTGGGCGTCGACGATATTTCCCAGGCGCCCGTCGACGACTTGGAGGAGGAAAAGGCCACCACGGCCGTCCAC
CACTCCGCCTCGACGCGCAGCCGCCACACCGCCACCAGCCGCCGCGTCTCCTCCCAGGCCCAAACCATTACCGAG
GCGCCAACCGTGGTGCCTCTCCCCTTTAGCGTGCCCGTCATCAAGGACAGCGACACCTCTCAAGATGAGGAGCAA
GATGGCCGCTCCTCCGTAGCCACCTTTGCCGAGGACGGGGATGCGCTGGGCCCGCCTCAGCGCCATGAATCCTTT
TACAAGCGCCTCTCGCGCGGGTCGGCCTCGTTGCTGCGCAGTCTCTCCCAGCGGTCCGGCCGGGGGGGCGACGAG
GTGGCTCCCACGCCGCCAACGGGCAGCAGTTCCGAGGAGCTGGTAATACCGCGGCAGCAGTACAGACGCGACGAC
GACAATGGATCCTTGGCTGCAACGGTGGACATTGACAGCGACAGTATGAGTGGCGGTGATGTTGGGTCGCTGGGG
ACGCCAGAGTCGCGCAGAAGCATTGAGATGGAGGCCAAGGAGTCGTCGACATTGCCAGCTTCGTTGGCCGCAAAA
ACAAACACATCTCCTTGCAAGATGCAATCGCCAGCCTCTTCTCCGGCAAAAACAATCTTGCACCACTCCAAAATG
CAATCGCCAGCTTCCTCTCCGGCAAAAACAAACCCTCAGGGCGACGACGACGCCGCCTCGGTCAGCAACACCCCC
AAACACTCCCCCCGCCCCAAGTCTGGCATCTCCATCGCCTCGACGCGCGCCAGCCTCACCAAGGAAAAACTGCCC
GCCTCGCTCTCCAAAGTCGCCCTCTCGTACCGCACCAACGAATGGGCCAAGCACCTCAGCTACGCCGACGTGCCC
AACGACCCCCCAGACGACGCGTCGAGCGCCGACGACGACGAGCCCGCCGAGCGCACTGCTCCCCTCGATGCCGTG
GAGCTGCAAAAGACGGCCCAGGACGGCGCGCCCCTGCCTGCAATGTCTATTCGCCGCAGCGAGTCGCAGGCCTCC
ATGGCCTCCTTTTCGCCCACTGTGGTGTCGAAGCGTGCCTCCAAGCCAGACTTGCCGGCGGCTCAGGGGCTGCAG
GAGAGGGAGAGTCAGCTTTTTCGTCTCTCGCCTGCTTCCCAAGCCCACCAAGATAGAGAGAGCCAGCTTTTCCGC
CTCTCGCCCGCTTCCCAAGCCCACCAAGATAGAGAAAGCCAATCCTCCCGCCTCGCCAGCCCGCTGCGCCGCGTC
TCCTCTCGTCCCGAGGGCCTGCCCACCTCGTACTCGGCCTCGTCGCTGCCCCAGGAGCGAGACTTGAGCGCCAAA
GACGTCACCTCCATCGAGGCCAACTCGCGCAGCCCCGCGTCGCTGCGCACCCCCACGCGCAGAGCCTCGTCTGGC
TTCCAGCCCATTGTTCAGGAGCGCCGCACCACAATGCAGGCCGACGCCATTCCCGAAGAGCCAGCCGAAGCCGCC
CGCCCCATTTCCGTCGGCCCGTCGCAGCGCTCCTCGGCCATTTCCGGCGTCGTCTCCTACGCCAATCCGCAAACC
CTCCTCGGCCAGCGCGAACTCCTCCTCCGCAACAAGTCCCAGGGCAGCCTCGTCGTTGCCGGCCCGGGCAGCGAC
TCTGGCTCCGGCTCTCCCCGCCACTCCCTAACGGCTTATCCGCCCTCCCAATTCCCCATGCCCGACCCAGACGAC
CTGCCCCTCAGCCAGCGCCGCCAAATCATGCGTCAGAGCAGCCTCATGTCCCTCCCTGGCTCCAACCCCTGGCCC
GCTGCCGGCCCCCACGAAAGCTCTGAAAACTTGCCCTTCAACTCCCACCAGCCTCGCCGCTCCTCGGGTCTCCCT
TCTTCCTCCTCGCGCGAAGCCCAACTGGCAAACTTTCGCCAATCCGTCCTCCACGACTTGCGCGCTGGAACTCCC
CTCCTCGCTACCCAGGGCCGCGAAACTCCCTTCAAACCAACCTCCCTCCTCGCCAACCGCGACGCAGAGGTGCAG
CGAAATATTGAAATGCAGCGCAACGTCCTCATTGGCCAAAAGGAGGCCGAGGCCCAGCGCCGTGAGCGCGAGCGC
CTCGATAGGGAGAATGCAGATCGCATTTTTGACGAGCGCATGCGTAATGGCAACTTGATTGAAGCTCACCGCGAG
GCTATGCGCAGGATGCAGCGCGCTGCTAGAAATCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail