Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1777
Gene name
LocationContig_15:199053..202217
Strand+
Gene length (bp)3164
Transcript length (bp)3111
Coding sequence length (bp)3111
Protein length (aa) 1037

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.4E-16 494 580

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 448 470 22
2 490 512 22
3 558 580 22
4 912 934 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1777
MASRSYFSPLEVQEMTLVRRFHTTAFKSVAFNTQFPPFMTSEYALAPFSVESETSKKNANLTAQTTKYSAQLNCW
PTNVSEITGSGGRKVAYLLSDTQGCNVRVLRRRYFPQPYNTSFVFRWNWEERVDTVKSPECFRTPESKHQLTVLF
SRERKHDNDSKAEQGQGTTEFAHTPMFCQAQYYQQQVMATVSTDGLRPYDASVKPVSDQVPFDFSYFNLTLFETL
ASHETFGKAGQASKVKQDADEILQFTTAGEYFLTWEYPAPFIYSKPNFSEHDFYEPETLERELKQTFKLLFSLAV
SQTLANQTTGIDQETASLTSEMAGIIVSRVFSALVESLFVLNAALSLILLYTCRKSQCCLSLNPNSISRLCGIDC
PADAGKAFSEASNLDEKRFGLFLGHHVFRLRQNQPQQGAEIYFERVSGCEGPDISSLSAKGKKENADIRPFALTQ
RAGTLLVLVLIGSIATLIGLKMREVAQNGLSRPSNKSLALRVITKYIPTIFATLLEAFWVLLNRHYCTLQPFQKL
CAGKARPSKTIETTYSAVPPPLALWRAIKAHHFNLAAVCVVTLLGNLLGIGLGALLNENETIVKYPRVFSPIHPD
FDRLGSNDPNRLISQHHFQHLLANMSSETPLSPWLSREYFFQPYSVGDEQSPGNYMLRTRGFGAHANCKPISDLP
IPTDFSNNITDWSNANWCNEGAVKMTGWFWAIQSIPDDGQRPKFHQGSPMSLESGCSPDDASGKSLGYPCTPEFT
TGWARLSSEISQLQVSAVHCQPSLDVAIFDVVVDGMGLVQSYTRVTDVQLEPTLESSANLMLKMTTQVLGQRHMI
WHNDTRSADPMSSMILTLTEERDFLNATLPPPDPSKLVPTIEQAFQRYFSMALSIDQDKLNLPEANSSETGYILA
TERRIFMDNRAFAIALAVLSIDILFAAIFLTWPWDVIRVLPRMPNDLASTLAYITPSRLMTTEWKETALGERTLS
FGRYTGSDGKEHVGIEFDPHVQLLDAKRPSWTERLKKKQSDGKSSGISWHYRLLNHRRNDS*
Coding >OphauB2|1777
ATGGCTTCTCGGTCTTACTTCTCGCCATTGGAGGTTCAGGAGATGACGCTTGTTCGCCGGTTCCACACTACGGCA
TTCAAATCGGTAGCCTTCAATACGCAATTTCCCCCATTCATGACATCGGAATATGCCTTGGCTCCATTTTCAGTG
GAATCTGAAACATCCAAGAAGAATGCAAACTTGACGGCCCAGACCACCAAATACTCTGCACAACTCAATTGCTGG
CCCACCAATGTATCAGAAATTACGGGGTCGGGTGGAAGGAAGGTGGCATATCTCCTTTCCGACACCCAAGGATGC
AACGTTCGAGTCTTGAGACGTCGGTATTTTCCTCAACCATATAATACTTCTTTTGTATTCCGATGGAACTGGGAG
GAGCGTGTTGATACCGTGAAAAGCCCTGAATGTTTCAGGACGCCTGAATCGAAGCACCAACTCACAGTCTTGTTC
AGCCGGGAACGAAAGCATGACAATGACAGCAAAGCCGAACAGGGCCAAGGCACAACGGAGTTTGCACACACACCC
ATGTTCTGCCAAGCCCAGTACTACCAGCAACAGGTCATGGCAACAGTCAGCACGGATGGATTGAGGCCTTATGAT
GCCTCGGTCAAGCCCGTGTCTGATCAAGTGCCATTCGACTTCTCCTACTTCAACTTGACGCTGTTCGAGACACTT
GCATCGCATGAAACGTTTGGCAAAGCAGGCCAGGCCTCCAAGGTGAAGCAAGACGCGGATGAAATACTACAATTT
ACAACTGCGGGCGAATACTTTCTCACTTGGGAATATCCAGCGCCCTTTATTTATTCCAAGCCAAACTTTTCAGAG
CACGACTTTTACGAACCAGAGACGCTCGAGCGCGAGTTGAAACAAACTTTTAAGCTCCTCTTTTCCCTCGCTGTT
TCGCAAACACTGGCCAATCAAACAACGGGAATAGACCAAGAAACAGCATCACTCACCTCGGAAATGGCAGGAATC
ATAGTCAGCAGAGTTTTTTCAGCCCTTGTGGAGAGTCTGTTTGTTTTAAATGCTGCCTTGTCTCTAATACTGCTC
TACACTTGTCGAAAATCCCAGTGCTGCTTGAGCCTGAACCCAAACTCCATCTCACGTCTTTGCGGAATTGACTGC
CCTGCTGACGCGGGCAAAGCATTTTCCGAGGCTAGCAACCTTGACGAAAAAAGATTTGGTCTCTTTTTAGGGCAT
CATGTTTTTCGGCTCCGACAAAATCAGCCACAACAAGGGGCAGAGATCTACTTTGAAAGAGTGTCTGGTTGCGAG
GGTCCAGACATTTCTTCACTCTCGGCCAAAGGGAAAAAGGAAAACGCCGACATTCGCCCATTTGCATTAACGCAA
AGAGCTGGGACGCTGCTTGTTTTGGTCTTGATTGGCTCAATTGCAACGTTGATTGGGCTGAAAATGCGTGAAGTT
GCTCAAAACGGGCTGTCTCGGCCATCGAATAAAAGTTTGGCTTTGAGAGTAATCACCAAGTACATTCCAACAATT
TTTGCAACACTGCTTGAAGCTTTCTGGGTCCTGCTCAACCGGCATTATTGCACTTTGCAGCCTTTTCAAAAGCTA
TGTGCTGGAAAGGCACGGCCAAGCAAGACAATAGAAACGACGTACTCGGCTGTGCCACCACCGCTGGCGCTATGG
AGAGCCATCAAAGCACATCACTTTAACCTTGCCGCAGTCTGTGTCGTTACTTTGTTGGGCAATCTCCTAGGAATC
GGTCTTGGTGCTTTGCTCAACGAAAACGAGACCATTGTGAAATACCCGCGCGTCTTTTCACCAATACACCCAGAT
TTCGATAGGCTAGGCTCCAATGACCCAAACAGGCTCATTTCACAGCACCATTTTCAGCATTTACTCGCCAACATG
TCATCAGAGACACCCTTGTCTCCCTGGTTATCAAGAGAATACTTCTTCCAGCCCTATAGTGTAGGCGACGAACAG
TCTCCTGGAAATTACATGCTCAGGACTCGAGGCTTTGGGGCCCATGCCAACTGCAAACCAATTTCCGACCTTCCA
ATACCAACTGATTTTAGTAACAACATTACTGATTGGTCAAATGCGAACTGGTGTAATGAGGGTGCCGTCAAGATG
ACGGGCTGGTTTTGGGCGATTCAATCCATTCCCGATGATGGCCAGAGGCCTAAATTTCACCAAGGTTCTCCAATG
TCTCTGGAATCAGGATGTAGCCCTGACGACGCCTCAGGAAAAAGTCTAGGATATCCGTGTACACCGGAATTCACT
ACTGGTTGGGCAAGACTTTCATCAGAGATTAGCCAACTCCAGGTCAGCGCAGTGCATTGCCAGCCTTCCTTGGAC
GTGGCAATATTCGACGTGGTGGTGGATGGAATGGGACTTGTACAATCGTACACTCGAGTGACTGATGTCCAGCTG
GAGCCAACACTTGAAAGTTCAGCAAACTTGATGCTCAAGATGACAACACAAGTTCTCGGTCAAAGACACATGATA
TGGCATAACGATACTCGCAGTGCCGACCCAATGTCGTCCATGATTTTAACATTGACGGAAGAGAGAGACTTTTTA
AACGCCACCTTGCCACCTCCAGATCCAAGCAAACTCGTTCCCACCATTGAGCAAGCCTTTCAGCGATATTTTTCA
ATGGCTCTCTCAATTGATCAGGACAAACTCAATCTTCCTGAAGCTAATAGCTCTGAAACAGGCTATATATTAGCT
ACCGAGAGACGCATATTCATGGACAATAGAGCGTTTGCTATTGCGCTCGCCGTCTTGTCCATTGATATCCTCTTT
GCAGCTATTTTCCTAACTTGGCCATGGGACGTGATTCGGGTTCTCCCACGAATGCCAAATGATCTGGCATCTACG
CTTGCATACATTACGCCTAGTCGACTAATGACAACGGAATGGAAAGAGACTGCATTAGGGGAAAGAACGCTGAGT
TTTGGACGATATACAGGATCGGACGGGAAAGAGCATGTTGGAATTGAATTCGATCCCCATGTGCAACTCCTCGAT
GCTAAAAGGCCCTCTTGGACTGAAAGGCTTAAGAAGAAGCAGAGTGATGGCAAGTCGTCGGGAATATCGTGGCAT
TATAGGTTGTTGAATCATCGACGCAACGATTCTTGA
Transcript >OphauB2|1777
ATGGCTTCTCGGTCTTACTTCTCGCCATTGGAGGTTCAGGAGATGACGCTTGTTCGCCGGTTCCACACTACGGCA
TTCAAATCGGTAGCCTTCAATACGCAATTTCCCCCATTCATGACATCGGAATATGCCTTGGCTCCATTTTCAGTG
GAATCTGAAACATCCAAGAAGAATGCAAACTTGACGGCCCAGACCACCAAATACTCTGCACAACTCAATTGCTGG
CCCACCAATGTATCAGAAATTACGGGGTCGGGTGGAAGGAAGGTGGCATATCTCCTTTCCGACACCCAAGGATGC
AACGTTCGAGTCTTGAGACGTCGGTATTTTCCTCAACCATATAATACTTCTTTTGTATTCCGATGGAACTGGGAG
GAGCGTGTTGATACCGTGAAAAGCCCTGAATGTTTCAGGACGCCTGAATCGAAGCACCAACTCACAGTCTTGTTC
AGCCGGGAACGAAAGCATGACAATGACAGCAAAGCCGAACAGGGCCAAGGCACAACGGAGTTTGCACACACACCC
ATGTTCTGCCAAGCCCAGTACTACCAGCAACAGGTCATGGCAACAGTCAGCACGGATGGATTGAGGCCTTATGAT
GCCTCGGTCAAGCCCGTGTCTGATCAAGTGCCATTCGACTTCTCCTACTTCAACTTGACGCTGTTCGAGACACTT
GCATCGCATGAAACGTTTGGCAAAGCAGGCCAGGCCTCCAAGGTGAAGCAAGACGCGGATGAAATACTACAATTT
ACAACTGCGGGCGAATACTTTCTCACTTGGGAATATCCAGCGCCCTTTATTTATTCCAAGCCAAACTTTTCAGAG
CACGACTTTTACGAACCAGAGACGCTCGAGCGCGAGTTGAAACAAACTTTTAAGCTCCTCTTTTCCCTCGCTGTT
TCGCAAACACTGGCCAATCAAACAACGGGAATAGACCAAGAAACAGCATCACTCACCTCGGAAATGGCAGGAATC
ATAGTCAGCAGAGTTTTTTCAGCCCTTGTGGAGAGTCTGTTTGTTTTAAATGCTGCCTTGTCTCTAATACTGCTC
TACACTTGTCGAAAATCCCAGTGCTGCTTGAGCCTGAACCCAAACTCCATCTCACGTCTTTGCGGAATTGACTGC
CCTGCTGACGCGGGCAAAGCATTTTCCGAGGCTAGCAACCTTGACGAAAAAAGATTTGGTCTCTTTTTAGGGCAT
CATGTTTTTCGGCTCCGACAAAATCAGCCACAACAAGGGGCAGAGATCTACTTTGAAAGAGTGTCTGGTTGCGAG
GGTCCAGACATTTCTTCACTCTCGGCCAAAGGGAAAAAGGAAAACGCCGACATTCGCCCATTTGCATTAACGCAA
AGAGCTGGGACGCTGCTTGTTTTGGTCTTGATTGGCTCAATTGCAACGTTGATTGGGCTGAAAATGCGTGAAGTT
GCTCAAAACGGGCTGTCTCGGCCATCGAATAAAAGTTTGGCTTTGAGAGTAATCACCAAGTACATTCCAACAATT
TTTGCAACACTGCTTGAAGCTTTCTGGGTCCTGCTCAACCGGCATTATTGCACTTTGCAGCCTTTTCAAAAGCTA
TGTGCTGGAAAGGCACGGCCAAGCAAGACAATAGAAACGACGTACTCGGCTGTGCCACCACCGCTGGCGCTATGG
AGAGCCATCAAAGCACATCACTTTAACCTTGCCGCAGTCTGTGTCGTTACTTTGTTGGGCAATCTCCTAGGAATC
GGTCTTGGTGCTTTGCTCAACGAAAACGAGACCATTGTGAAATACCCGCGCGTCTTTTCACCAATACACCCAGAT
TTCGATAGGCTAGGCTCCAATGACCCAAACAGGCTCATTTCACAGCACCATTTTCAGCATTTACTCGCCAACATG
TCATCAGAGACACCCTTGTCTCCCTGGTTATCAAGAGAATACTTCTTCCAGCCCTATAGTGTAGGCGACGAACAG
TCTCCTGGAAATTACATGCTCAGGACTCGAGGCTTTGGGGCCCATGCCAACTGCAAACCAATTTCCGACCTTCCA
ATACCAACTGATTTTAGTAACAACATTACTGATTGGTCAAATGCGAACTGGTGTAATGAGGGTGCCGTCAAGATG
ACGGGCTGGTTTTGGGCGATTCAATCCATTCCCGATGATGGCCAGAGGCCTAAATTTCACCAAGGTTCTCCAATG
TCTCTGGAATCAGGATGTAGCCCTGACGACGCCTCAGGAAAAAGTCTAGGATATCCGTGTACACCGGAATTCACT
ACTGGTTGGGCAAGACTTTCATCAGAGATTAGCCAACTCCAGGTCAGCGCAGTGCATTGCCAGCCTTCCTTGGAC
GTGGCAATATTCGACGTGGTGGTGGATGGAATGGGACTTGTACAATCGTACACTCGAGTGACTGATGTCCAGCTG
GAGCCAACACTTGAAAGTTCAGCAAACTTGATGCTCAAGATGACAACACAAGTTCTCGGTCAAAGACACATGATA
TGGCATAACGATACTCGCAGTGCCGACCCAATGTCGTCCATGATTTTAACATTGACGGAAGAGAGAGACTTTTTA
AACGCCACCTTGCCACCTCCAGATCCAAGCAAACTCGTTCCCACCATTGAGCAAGCCTTTCAGCGATATTTTTCA
ATGGCTCTCTCAATTGATCAGGACAAACTCAATCTTCCTGAAGCTAATAGCTCTGAAACAGGCTATATATTAGCT
ACCGAGAGACGCATATTCATGGACAATAGAGCGTTTGCTATTGCGCTCGCCGTCTTGTCCATTGATATCCTCTTT
GCAGCTATTTTCCTAACTTGGCCATGGGACGTGATTCGGGTTCTCCCACGAATGCCAAATGATCTGGCATCTACG
CTTGCATACATTACGCCTAGTCGACTAATGACAACGGAATGGAAAGAGACTGCATTAGGGGAAAGAACGCTGAGT
TTTGGACGATATACAGGATCGGACGGGAAAGAGCATGTTGGAATTGAATTCGATCCCCATGTGCAACTCCTCGAT
GCTAAAAGGCCCTCTTGGACTGAAAGGCTTAAGAAGAAGCAGAGTGATGGCAAGTCGTCGGGAATATCGTGGCAT
TATAGGTTGTTGAATCATCGACGCAACGATTCTTGA
Gene >OphauB2|1777
ATGGCTTCTCGGTCTTACTTCTCGCCATTGGAGGTTCAGGAGATGACGCTTGTTCGCCGGTTCCACACTACGGCA
TTCAAATCGGTAGCCTTCAATACGCAATTTCCCCCATTCATGACATCGGAATATGCCTTGGCTCCATTTTCAGTG
GAATCTGAAACATCCAAGAAGAATGCAAACTTGACGGCCCAGACCACCAAATACTCTGCACAACTCAATTGCTGG
CCCACCAATGTATCAGAAATTACGGGGTCGGGTGGAAGGAAGGTGGCATATCTCCTTTCCGACACCCAAGGATGC
AACGTTCGAGTCTTGAGACGTCGGTATTTTCCTCAACCATATAATACTTCTTTTGTATTCCGATGGAACTGGGAG
GAGCGTGTTGATACCGTGAAAAGCCCTGAATGTTTCAGGACGCCTGAATCGAAGCACCAACTCACAGTCTTGTTC
AGCCGGGAACGAAAGCATGACAATGACAGCAAAGCCGAACAGGGCCAAGGCACAACGGAGTTTGCACACACACCC
ATGTTCTGCCAAGCCCAGTACTACCAGCAACAGGTCATGGCAACAGTCAGCACGGATGGATTGAGGCCTTATGAT
GCCTCGGTCAAGCCCGTGTCTGATCAAGTGCCATTCGACTTCTCCTACTTCAACTTGACGCTGTTCGAGACACTT
GCATCGCATGAAACGTTTGGCAAAGCAGGCCAGGCCTCCAAGGTGAAGCAAGACGCGGATGAAATACTACAATTT
ACAACTGCGGGCGAATACTTTCTCACTTGGGAATATCCAGCGCCCTTTATTTATTCCAAGCCAAACTTTTCAGAG
CACGACTTTTACGAACCAGAGACGCTCGAGCGCGAGTTGAAACAAACTTTTAAGCTCCTCTTTTCCCTCGCTGTT
TCGCAAACACTGGCCAATCAAACAACGGGAATAGACCAAGAAACAGCATCACTCACCTCGGAAATGGCAGGAATC
ATAGTCAGCAGAGTTTTTTCAGCCCTTGTGGAGAGTCTGTTTGTTTTAAATGCTGCCTTGTCTCTAATACTGCTC
TACACTTGTCGAAAATCCCAGTGCTGCTTGAGCCTGAACCCAAACTCCATCTCACGTCTTTGCGGAATTGACTGC
CCTGCTGACGCGGGCAAAGCATTTTCCGAGGCTAGCAACCTTGACGAAAAAAGATTTGGTCTCTTTTTAGGGCAT
CATGTTTTTCGGCTCCGACAAAATCAGCCACAACAAGGGGCAGAGATCTACTTTGAAAGAGTGTCTGGTTGCGAG
GGTCCAGACATTTCTTCACTCTCGGCCAAAGGGAAAAAGGAAAACGCCGACATTCGCCCATTTGCATTAACGCAA
AGAGCTGGGACGCTGCTTGTTTTGGTCTTGATTGGCTCAATTGCAACGTTGATTGGGCTGAAAATGCGTGAAGTT
GCTCAAAACGGTACGAGTCGTTCCCTGTGAAAGAAAGGTCAGTTTATGCTAACAGGTCTGTAGGGCTGTCTCGGC
CATCGAATAAAAGTTTGGCTTTGAGAGTAATCACCAAGTACATTCCAACAATTTTTGCAACACTGCTTGAAGCTT
TCTGGGTCCTGCTCAACCGGCATTATTGCACTTTGCAGCCTTTTCAAAAGCTATGTGCTGGAAAGGCACGGCCAA
GCAAGACAATAGAAACGACGTACTCGGCTGTGCCACCACCGCTGGCGCTATGGAGAGCCATCAAAGCACATCACT
TTAACCTTGCCGCAGTCTGTGTCGTTACTTTGTTGGGCAATCTCCTAGGAATCGGTCTTGGTGCTTTGCTCAACG
AAAACGAGACCATTGTGAAATACCCGCGCGTCTTTTCACCAATACACCCAGATTTCGATAGGCTAGGCTCCAATG
ACCCAAACAGGCTCATTTCACAGCACCATTTTCAGCATTTACTCGCCAACATGTCATCAGAGACACCCTTGTCTC
CCTGGTTATCAAGAGAATACTTCTTCCAGCCCTATAGTGTAGGCGACGAACAGTCTCCTGGAAATTACATGCTCA
GGACTCGAGGCTTTGGGGCCCATGCCAACTGCAAACCAATTTCCGACCTTCCAATACCAACTGATTTTAGTAACA
ACATTACTGATTGGTCAAATGCGAACTGGTGTAATGAGGGTGCCGTCAAGATGACGGGCTGGTTTTGGGCGATTC
AATCCATTCCCGATGATGGCCAGAGGCCTAAATTTCACCAAGGTTCTCCAATGTCTCTGGAATCAGGATGTAGCC
CTGACGACGCCTCAGGAAAAAGTCTAGGATATCCGTGTACACCGGAATTCACTACTGGTTGGGCAAGACTTTCAT
CAGAGATTAGCCAACTCCAGGTCAGCGCAGTGCATTGCCAGCCTTCCTTGGACGTGGCAATATTCGACGTGGTGG
TGGATGGAATGGGACTTGTACAATCGTACACTCGAGTGACTGATGTCCAGCTGGAGCCAACACTTGAAAGTTCAG
CAAACTTGATGCTCAAGATGACAACACAAGTTCTCGGTCAAAGACACATGATATGGCATAACGATACTCGCAGTG
CCGACCCAATGTCGTCCATGATTTTAACATTGACGGAAGAGAGAGACTTTTTAAACGCCACCTTGCCACCTCCAG
ATCCAAGCAAACTCGTTCCCACCATTGAGCAAGCCTTTCAGCGATATTTTTCAATGGCTCTCTCAATTGATCAGG
ACAAACTCAATCTTCCTGAAGCTAATAGCTCTGAAACAGGCTATATATTAGCTACCGAGAGACGCATATTCATGG
ACAATAGAGCGTTTGCTATTGCGCTCGCCGTCTTGTCCATTGATATCCTCTTTGCAGCTATTTTCCTAACTTGGC
CATGGGACGTGATTCGGGTTCTCCCACGAATGCCAAATGATCTGGCATCTACGCTTGCATACATTACGCCTAGTC
GACTAATGACAACGGAATGGAAAGAGACTGCATTAGGGGAAAGAACGCTGAGTTTTGGACGATATACAGGATCGG
ACGGGAAAGAGCATGTTGGAATTGAATTCGATCCCCATGTGCAACTCCTCGATGCTAAAAGGCCCTCTTGGACTG
AAAGGCTTAAGAAGAAGCAGAGTGATGGCAAGTCGTCGGGAATATCGTGGCATTATAGGTTGTTGAATCATCGAC
GCAACGATTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail