Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1764
Gene name
LocationContig_15:149588..152261
Strand-
Gene length (bp)2673
Transcript length (bp)2328
Coding sequence length (bp)2328
Protein length (aa) 776

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 1.6E-59 366 738
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 1.4E-16 10 126
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 6.2E-06 148 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39623|SPSC_BACSU Spore coat polysaccharide biosynthesis protein SpsC OS=Bacillus subtilis (strain 168) GN=spsC PE=3 SV=1 358 730 4.0E-36
sp|Q6T1W6|FDTB_ANETH dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase OS=Aneurinibacillus thermoaerophilus GN=fdtB PE=1 SV=1 388 653 1.0E-31
sp|Q07608|MOSB_RHIML Protein MosB OS=Rhizobium meliloti GN=mosB PE=3 SV=1 323 649 8.0E-29
sp|Q70KD4|GLADA_MICEC Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase OS=Micromonospora echinospora GN=gtmD PE=3 SV=1 357 669 1.0E-28
sp|Q7DBF3|GDPPS_ECO57 GDP-perosamine synthase OS=Escherichia coli O157:H7 GN=perA PE=1 SV=1 358 595 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39623|SPSC_BACSU Spore coat polysaccharide biosynthesis protein SpsC OS=Bacillus subtilis (strain 168) GN=spsC PE=3 SV=1 358 730 4.0E-36
sp|Q6T1W6|FDTB_ANETH dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase OS=Aneurinibacillus thermoaerophilus GN=fdtB PE=1 SV=1 388 653 1.0E-31
sp|Q07608|MOSB_RHIML Protein MosB OS=Rhizobium meliloti GN=mosB PE=3 SV=1 323 649 8.0E-29
sp|Q70KD4|GLADA_MICEC Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase OS=Micromonospora echinospora GN=gtmD PE=3 SV=1 357 669 1.0E-28
sp|Q7DBF3|GDPPS_ECO57 GDP-perosamine synthase OS=Escherichia coli O157:H7 GN=perA PE=1 SV=1 358 595 2.0E-28
sp|Q9A9H3|GDPPS_CAUCR GDP-perosamine synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=per PE=1 SV=1 358 621 2.0E-26
sp|Q58466|Y1066_METJA Uncharacterized protein MJ1066 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1066 PE=3 SV=1 388 739 2.0E-26
sp|Q06953|GDPPS_VIBCL GDP-perosamine synthase OS=Vibrio cholerae GN=rfbE PE=1 SV=1 388 738 2.0E-26
sp|Q8EEB1|KDNA_SHEON 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase OS=Shewanella oneidensis (strain MR-1) GN=kdnA PE=1 SV=1 357 650 4.0E-25
sp|Q8G8Y2|GLDSA_BACCI L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Bacillus circulans GN=btrR PE=1 SV=1 388 742 1.0E-23
sp|Q9ZGH4|DESV_STRVZ dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase OS=Streptomyces venezuelae GN=desV PE=1 SV=1 360 729 2.0E-22
sp|Q2MFP2|GLDSA_STRRY L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces rimosus subsp. paromomycinus GN=parS PE=3 SV=1 388 621 2.0E-22
sp|B2VBJ1|ARNB_ERWT9 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=arnB PE=3 SV=1 386 669 4.0E-22
sp|A6TFA0|ARNB_KLEP7 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=arnB PE=3 SV=2 386 666 1.0E-21
sp|Q53U20|GLDSA_STRFR L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces fradiae GN=neoB PE=1 SV=1 388 614 2.0E-21
sp|B5XTK7|ARNB_KLEP3 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=arnB PE=3 SV=1 386 666 5.0E-21
sp|A8GDR5|ARNB_SERP5 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Serratia proteamaculans (strain 568) GN=arnB PE=3 SV=1 386 666 6.0E-21
sp|Q4ZSZ4|ARNB_PSEU2 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=arnB PE=3 SV=1 386 666 7.0E-21
sp|Q4R0W2|GLDSA_STRRI L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces ribosidificus GN=rbmB PE=3 SV=1 379 615 7.0E-21
sp|Q6L739|GLDSA_STRKN L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces kanamyceticus GN=kanB PE=3 SV=1 356 544 2.0E-20
sp|B1JJ28|ARNB_YERPY UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=arnB PE=3 SV=1 382 668 2.0E-20
sp|Q7BF87|ARNB_YERPS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=arnB PE=2 SV=1 382 668 2.0E-20
sp|A4TIM2|ARNB_YERPP UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis (strain Pestoides F) GN=arnB PE=3 SV=1 382 668 2.0E-20
sp|Q1CIH5|ARNB_YERPN UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=arnB PE=3 SV=1 382 668 2.0E-20
sp|A9R095|ARNB_YERPG UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=arnB PE=3 SV=1 382 668 2.0E-20
sp|Q93PE0|ARNB_YERPE UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis GN=arnB PE=3 SV=1 382 668 2.0E-20
sp|B2K5L5|ARNB_YERPB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=arnB PE=3 SV=1 382 668 2.0E-20
sp|Q1C740|ARNB_YERPA UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=arnB PE=3 SV=1 382 668 2.0E-20
sp|A7FHH2|ARNB_YERP3 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=arnB PE=3 SV=1 382 668 2.0E-20
sp|P77952|GLSA_STRGR L-glutamine:scyllo-inosose aminotransferase OS=Streptomyces griseus GN=stsC PE=1 SV=1 336 648 2.0E-20
sp|Q2MF12|GLADA_STRSD Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase OS=Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / NCIB 11028) GN=tobS2 PE=3 SV=1 380 669 3.0E-20
sp|A4WAM5|ARNB_ENT38 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Enterobacter sp. (strain 638) GN=arnB PE=3 SV=1 386 665 3.0E-20
sp|Q4KC84|ARNB_PSEF5 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=arnB PE=3 SV=2 363 670 3.0E-20
sp|Q6L733|GLADA_STRKN Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase OS=Streptomyces kanamyceticus GN=kanD PE=3 SV=1 385 669 4.0E-20
sp|Q6D2E9|ARNB_PECAS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=arnB PE=3 SV=1 386 672 4.0E-20
sp|Q2MF71|GLDSA_STRLV L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces lividus GN=livS PE=3 SV=1 356 552 5.0E-20
sp|A1JPP9|ARNB_YERE8 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=arnB PE=3 SV=1 358 666 6.0E-20
sp|Q3KCC3|ARNB_PSEPF UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=arnB PE=3 SV=1 386 672 6.0E-20
sp|A4SQW7|ARNB_AERS4 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Aeromonas salmonicida (strain A449) GN=arnB PE=3 SV=1 388 672 1.0E-19
sp|O52552|RIFK_AMYMS 3-amino-5-hydroxybenzoate synthase OS=Amycolatopsis mediterranei (strain S699) GN=rifK PE=1 SV=2 357 672 1.0E-19
sp|Q2NRV5|ARNB_SODGM UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Sodalis glossinidius (strain morsitans) GN=arnB PE=3 SV=1 399 666 1.0E-19
sp|C6DAW7|ARNB_PECCP UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=arnB PE=3 SV=1 399 672 2.0E-19
sp|Q2MF17|GLDSA_STRSD L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / NCIB 11028) GN=tbmB PE=3 SV=1 356 552 3.0E-19
sp|B7VBN4|ARNB_PSEA8 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=arnB PE=3 SV=1 362 666 3.0E-19
sp|Q02R23|ARNB_PSEAB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=arnB PE=3 SV=1 362 666 3.0E-19
sp|Q6QVU4|GLDSA_MICEC L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Micromonospora echinospora GN=gntA PE=3 SV=1 356 553 4.0E-19
sp|Q9HY65|ARNB_PSEAE UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=arnB PE=3 SV=1 362 666 5.0E-19
sp|Q795J3|EPSN_BACSU Putative pyridoxal phosphate-dependent aminotransferase EpsN OS=Bacillus subtilis (strain 168) GN=epsN PE=2 SV=1 388 545 5.0E-19
sp|A0KGY8|ARNB_AERHH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=arnB PE=3 SV=1 388 672 5.0E-19
sp|P26398|RFBH_SALTY Lipopolysaccharide biosynthesis protein RfbH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbH PE=3 SV=1 388 669 9.0E-19
sp|Q9F837|MEDII_MICMH dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase OS=Micromonospora megalomicea subsp. nigra GN=megDII PE=1 SV=1 355 673 1.0E-18
sp|A6V1P2|ARNB_PSEA7 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas aeruginosa (strain PA7) GN=arnB PE=3 SV=1 362 666 1.0E-18
sp|C5BDQ4|ARNB_EDWI9 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Edwardsiella ictaluri (strain 93-146) GN=arnB PE=3 SV=1 386 670 2.0E-18
sp|B4TPI0|ARNB_SALSV UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=arnB PE=3 SV=2 386 666 2.0E-18
sp|B1IXT4|ARNB_ECOLC UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=arnB PE=3 SV=1 386 672 3.0E-18
sp|B7N5L8|ARNB_ECOLU UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=arnB PE=3 SV=2 386 672 3.0E-18
sp|Q7N3Q5|ARNB_PHOLL UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=arnB PE=3 SV=1 385 670 4.0E-18
sp|A9N5B4|ARNB_SALPB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=arnB PE=3 SV=1 399 666 5.0E-18
sp|B5R270|ARNB_SALEP UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=arnB PE=3 SV=2 399 666 5.0E-18
sp|B5EZH6|ARNB_SALA4 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella agona (strain SL483) GN=arnB PE=3 SV=1 399 666 5.0E-18
sp|B5FNT7|ARNB_SALDC UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella dublin (strain CT_02021853) GN=arnB PE=3 SV=2 399 666 7.0E-18
sp|Q8Z542|ARNB_SALTI UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella typhi GN=arnB PE=3 SV=2 399 666 1.0E-17
sp|Q8ZNF3|ARNB_SALTY UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=arnB PE=1 SV=2 399 666 1.0E-17
sp|C0Q071|ARNB_SALPC UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella paratyphi C (strain RKS4594) GN=arnB PE=3 SV=2 399 666 1.0E-17
sp|B4SYW9|ARNB_SALNS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella newport (strain SL254) GN=arnB PE=3 SV=2 399 666 1.0E-17
sp|B4TBG4|ARNB_SALHS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella heidelberg (strain SL476) GN=arnB PE=3 SV=2 399 666 1.0E-17
sp|B5BCP8|ARNB_SALPK UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=arnB PE=3 SV=2 399 666 1.0E-17
sp|Q5PNA4|ARNB_SALPA UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=arnB PE=3 SV=2 399 666 1.0E-17
sp|B7LM78|ARNB_ESCF3 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=arnB PE=3 SV=1 358 669 1.0E-17
sp|B4ETL5|ARNB_PROMH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Proteus mirabilis (strain HI4320) GN=arnB PE=3 SV=1 399 666 2.0E-17
sp|P15263|DEGT_GEOSE Pleiotropic regulatory protein OS=Geobacillus stearothermophilus GN=degT PE=3 SV=1 369 746 3.0E-17
sp|B5RCC2|ARNB_SALG2 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=arnB PE=3 SV=2 399 666 3.0E-17
sp|Q57M57|ARNB_SALCH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella choleraesuis (strain SC-B67) GN=arnB PE=3 SV=1 399 666 4.0E-17
sp|P25048|DNRJ_STRPE Daunorubicin biosynthesis sensory transduction protein DnrJ OS=Streptomyces peucetius GN=dnrJ PE=3 SV=1 355 647 4.0E-17
sp|Q3YZV3|ARNB_SHISS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shigella sonnei (strain Ss046) GN=arnB PE=3 SV=2 386 672 5.0E-17
sp|O25130|PSEC_HELPY UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pseC PE=1 SV=1 358 561 9.0E-17
sp|O07566|NTDA_BACSU 3-oxo-glucose-6-phosphate:glutamate aminotransferase OS=Bacillus subtilis (strain 168) GN=ntdA PE=1 SV=1 388 672 1.0E-16
sp|P14290|ERBS_SACEN Erythromycin biosynthesis sensory transduction protein EryC1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryC1 PE=3 SV=2 386 739 2.0E-16
sp|B7NNT2|ARNB_ECO7I UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=arnB PE=3 SV=2 386 672 2.0E-16
sp|Q31YK4|ARNB_SHIBS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=arnB PE=3 SV=2 386 672 3.0E-16
sp|B1LLK7|ARNB_ECOSM UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=arnB PE=3 SV=2 386 672 3.0E-16
sp|B6I7J6|ARNB_ECOSE UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain SE11) GN=arnB PE=3 SV=2 386 672 3.0E-16
sp|B7LAR8|ARNB_ECO55 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=arnB PE=3 SV=2 386 672 3.0E-16
sp|A7ZP71|ARNB_ECO24 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=arnB PE=3 SV=1 386 672 3.0E-16
sp|B7M5T5|ARNB_ECO8A UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=arnB PE=3 SV=2 386 672 3.0E-16
sp|Q83QT9|ARNB_SHIFL UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shigella flexneri GN=arnB PE=3 SV=5 386 672 4.0E-16
sp|Q0T2N0|ARNB_SHIF8 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=arnB PE=3 SV=1 386 672 4.0E-16
sp|B7UFR5|ARNB_ECO27 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=arnB PE=3 SV=2 386 666 6.0E-16
sp|B5YX44|ARNB_ECO5E UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=arnB PE=3 SV=2 399 672 7.0E-16
sp|Q7AC24|ARNB_ECO57 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O157:H7 GN=arnB PE=3 SV=2 399 672 7.0E-16
sp|P77690|ARNB_ECOLI UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain K12) GN=arnB PE=1 SV=2 386 672 8.0E-16
sp|A8A2C0|ARNB_ECOHS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=arnB PE=3 SV=1 386 672 8.0E-16
sp|B1X8W6|ARNB_ECODH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=arnB PE=3 SV=1 386 672 8.0E-16
sp|C4ZU95|ARNB_ECOBW UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=arnB PE=3 SV=1 386 672 8.0E-16
sp|Q1R9G2|ARNB_ECOUT UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=arnB PE=3 SV=2 386 672 9.0E-16
sp|Q8FFM3|ARNB_ECOL6 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=arnB PE=3 SV=2 386 672 9.0E-16
sp|Q0TFI9|ARNB_ECOL5 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=arnB PE=3 SV=2 386 672 9.0E-16
sp|A1ADA5|ARNB_ECOK1 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O1:K1 / APEC GN=arnB PE=3 SV=2 386 672 9.0E-16
sp|B7MG20|ARNB_ECO45 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=arnB PE=3 SV=2 386 672 9.0E-16
sp|B7MXT4|ARNB_ECO81 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=arnB PE=3 SV=2 386 672 1.0E-15
sp|A8FRR4|ARNB_SHESH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shewanella sediminis (strain HAW-EB3) GN=arnB PE=3 SV=1 399 666 6.0E-15
sp|Q9HZ76|WBPE_PSEAE UDP-2-acetamido-2-deoxy-3-oxo-D-glucuronate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpE PE=1 SV=1 388 548 2.0E-14
sp|Q5QKR7|PSEC_CAMJJ UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pseC PE=3 SV=1 388 646 2.0E-14
sp|Q6U1I3|VIOA_SHIDY dTDP-4-amino-4,6-dideoxy-D-glucose transaminase OS=Shigella dysenteriae GN=vioA PE=1 SV=1 380 548 2.0E-14
sp|P27833|WECE_ECOLI dTDP-4-amino-4,6-dideoxygalactose transaminase OS=Escherichia coli (strain K12) GN=wecE PE=1 SV=2 418 553 2.0E-14
sp|Q0P9D3|PGLE_CAMJE UDP-N-acetylbacillosamine transaminase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglE PE=1 SV=1 388 556 1.0E-13
sp|O13991|YEG9_SCHPO Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.09c PE=2 SV=3 9 297 3.0E-13
sp|Q0P8W3|PSEC_CAMJE UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pseC PE=1 SV=1 388 646 7.0E-13
sp|Q9XCW4|VIOA_ECOLX dTDP-4-amino-4,6-dideoxy-D-glucose transaminase OS=Escherichia coli GN=vioA PE=1 SV=1 380 514 1.0E-12
sp|O42896|YBQ3_SCHPO Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC115.03 PE=3 SV=1 8 263 3.0E-12
sp|Q04869|YM94_YEAST Uncharacterized protein YMR315W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR315W PE=1 SV=1 9 217 4.0E-12
sp|O32223|IOLW_BACSU scyllo-inositol 2-dehydrogenase (NADP(+)) OS=Bacillus subtilis (strain 168) GN=iolW PE=1 SV=1 10 201 1.0E-08
sp|Q7BUE1|RIFL_AMYMS Putative UDP-kanosamine synthase oxidoreductase subunit OS=Amycolatopsis mediterranei (strain S699) GN=rifL PE=1 SV=1 10 193 1.0E-08
sp|P77376|YDGJ_ECOLI Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) GN=ydgJ PE=3 SV=2 10 263 2.0E-08
sp|Q6M0B9|UGNO_METMP UDP-N-acetylglucosamine 3-dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0352 PE=1 SV=1 10 269 1.0E-07
sp|O68965|MI2D_RHIME Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=idhA PE=1 SV=2 80 260 6.0E-07
sp|C5BYN4|IOLG_BEUC1 Inositol 2-dehydrogenase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=iolG PE=3 SV=1 10 144 8.0E-07
sp|D4GP30|XDH2_HALVD D-xylose 1-dehydrogenase (NADP(+)) 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_B0029 PE=1 SV=1 10 204 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1764
MDGVGSRPPLKVAIIGIGHRGYKTHFLSILENPRAWKVVAVCDTSDEARARFASQHRGISTHGSHDELLAQHKTS
LDFAIVCLPHEHHLACCEALARAGVPVLKEKPVAESADEYERLARLPVKIGVCFQKRFEPRYLAVRDLLPLVGQV
ASFTATLSASIAALDATWRAQSDVGVTEDLGCHMLDMVVSLFGQPTAVAAQNTKGVRAEQAYGGDDVSNIIMNFG
PAAKHTMGHVHLSRVAHREQESLVITGTKGTFALEGRDVRLRDSAGNETFSLHDTSAKTYVVQSMLHAFSAWITG
TEPDFCCAVANLKNTVHVMDQVRGAYAKSRATDALSSLSLQAEPRLGASLQGAHHVWPLLSAESEDAVVRQMHSS
LSIYNRSDIYQVFEDRWRSMHSLKHALVCSSGTVAILHMFEALDLRPGDQVLCPVYTFFATASPLLQYGAVPVFC
DSLDDGNLDPAEILKRSTARTRAVIVTHMWGLPCRMQEILHNARKVGIKVLEDCSHAHGAMVNGKLVGSWGDMAA
WSLQAKKNVMGGQAGVMATNSTDYYSRAVLHGHFNKRAKEDVPADHSLRKFWLTGLGLNLRAHPLAIALANQQAN
LLPTHDHNRQTYASYMATRLAAIPFLKMPVVHDTQHDKHAWYAFVMQFDATKAPPGLSRDDFVAKLVDEHGLSEV
DIPRSTGLLNELPLFTHSHEAIPRFGNEPWGQVQPTTQFPRADAFFKAAIKLPVWATKADEHIVKHYVEKFLLVA
RECLQASEGPKDGKTSLSERVHARL*
Coding >OphauB2|1764
ATGGACGGTGTTGGTTCACGGCCTCCGCTCAAAGTGGCCATTATCGGGATTGGCCACCGCGGCTACAAGACGCAT
TTCCTATCCATTTTGGAAAATCCGCGGGCATGGAAAGTGGTGGCCGTGTGCGACACGAGCGACGAGGCGCGGGCG
CGCTTTGCCAGCCAGCACCGCGGCATCAGCACCCATGGCAGCCACGACGAGTTGCTGGCGCAGCACAAGACGAGC
CTCGACTTTGCCATTGTGTGTCTGCCGCACGAGCACCACTTGGCGTGCTGTGAGGCGCTGGCGCGGGCGGGCGTG
CCGGTGCTAAAGGAGAAGCCCGTGGCCGAGTCGGCAGACGAGTATGAGCGGCTGGCGAGGCTGCCGGTAAAGATT
GGCGTGTGTTTTCAAAAGAGGTTTGAGCCTCGCTATTTGGCGGTGAGGGATTTGCTGCCTCTGGTTGGGCAGGTG
GCGTCGTTTACGGCAACGTTGAGTGCGAGCATTGCGGCGCTGGATGCCACTTGGAGGGCGCAGAGCGATGTGGGC
GTCACGGAAGACCTGGGCTGCCACATGCTCGACATGGTCGTCTCCCTCTTTGGCCAGCCCACCGCCGTCGCCGCG
CAAAACACAAAGGGCGTGCGCGCCGAACAAGCCTATGGCGGCGACGACGTGTCCAACATCATTATGAATTTCGGC
CCCGCCGCCAAACACACCATGGGCCACGTTCATCTCTCGCGCGTCGCCCACCGCGAGCAAGAGTCGCTCGTCATT
ACCGGCACAAAGGGCACCTTTGCCCTCGAGGGCCGCGACGTGCGTCTGCGCGACAGCGCCGGCAACGAAACCTTT
TCGCTGCACGACACCTCGGCAAAGACGTACGTGGTGCAGTCCATGCTGCATGCCTTTTCCGCCTGGATCACGGGC
ACAGAGCCAGACTTTTGCTGCGCAGTGGCCAACTTGAAAAACACGGTGCATGTCATGGACCAGGTTCGCGGCGCC
TACGCAAAGTCGCGCGCCACGGATGCCCTCTCAAGTCTCTCACTCCAGGCCGAGCCTCGCCTTGGTGCCTCGCTT
CAGGGCGCTCACCATGTCTGGCCCCTCTTGTCGGCAGAGTCGGAAGACGCCGTTGTGCGCCAGATGCACTCTTCC
CTCTCCATCTACAACCGCTCCGACATTTACCAAGTCTTTGAGGACCGCTGGCGCTCAATGCACAGCCTCAAGCAC
GCCCTCGTCTGCAGCTCCGGCACCGTGGCTATTCTGCACATGTTTGAGGCGCTGGATCTGCGGCCGGGCGACCAA
GTCTTGTGTCCCGTCTACACCTTTTTCGCCACCGCCTCGCCCCTGCTGCAGTATGGCGCCGTGCCCGTCTTTTGC
GACTCGCTCGACGACGGGAACCTCGACCCGGCCGAGATTTTGAAGCGCTCCACTGCTCGCACAAGAGCCGTCATT
GTCACCCACATGTGGGGGCTGCCCTGCCGCATGCAAGAAATTCTTCATAATGCTCGCAAGGTGGGCATCAAGGTG
CTCGAGGATTGCTCCCATGCCCACGGCGCCATGGTCAATGGCAAGCTTGTTGGCTCTTGGGGCGACATGGCCGCC
TGGTCCTTGCAGGCCAAGAAGAATGTCATGGGCGGCCAGGCCGGCGTCATGGCCACAAACTCGACCGACTACTAC
TCTCGCGCCGTCCTTCACGGCCACTTTAACAAGCGTGCCAAGGAGGATGTGCCAGCAGACCACTCGCTGCGAAAG
TTTTGGCTCACCGGCCTCGGCCTCAACCTCCGCGCCCACCCCCTCGCCATTGCCCTCGCCAACCAACAAGCCAAC
CTCCTCCCCACCCACGACCACAACCGCCAAACCTACGCCTCCTACATGGCCACCCGCCTCGCCGCCATTCCCTTT
CTCAAAATGCCCGTCGTCCACGACACCCAGCACGACAAGCACGCCTGGTACGCCTTTGTCATGCAATTCGACGCC
ACCAAGGCTCCCCCTGGCCTCTCGCGCGATGACTTTGTCGCCAAGCTTGTCGACGAGCACGGCCTCTCTGAGGTC
GACATCCCACGCTCCACGGGCCTCTTAAACGAGCTGCCGCTCTTTACCCACTCGCACGAGGCCATTCCTAGATTT
GGAAACGAGCCTTGGGGTCAAGTCCAGCCTACTACGCAGTTTCCGCGCGCTGATGCCTTTTTCAAGGCTGCCATC
AAGTTGCCTGTTTGGGCCACCAAGGCTGACGAGCATATTGTCAAGCACTACGTTGAAAAGTTTTTGCTTGTGGCT
CGTGAGTGTTTGCAAGCCTCAGAGGGGCCCAAGGATGGCAAGACGAGCTTGAGCGAGCGTGTACATGCCAGATTG
TAG
Transcript >OphauB2|1764
ATGGACGGTGTTGGTTCACGGCCTCCGCTCAAAGTGGCCATTATCGGGATTGGCCACCGCGGCTACAAGACGCAT
TTCCTATCCATTTTGGAAAATCCGCGGGCATGGAAAGTGGTGGCCGTGTGCGACACGAGCGACGAGGCGCGGGCG
CGCTTTGCCAGCCAGCACCGCGGCATCAGCACCCATGGCAGCCACGACGAGTTGCTGGCGCAGCACAAGACGAGC
CTCGACTTTGCCATTGTGTGTCTGCCGCACGAGCACCACTTGGCGTGCTGTGAGGCGCTGGCGCGGGCGGGCGTG
CCGGTGCTAAAGGAGAAGCCCGTGGCCGAGTCGGCAGACGAGTATGAGCGGCTGGCGAGGCTGCCGGTAAAGATT
GGCGTGTGTTTTCAAAAGAGGTTTGAGCCTCGCTATTTGGCGGTGAGGGATTTGCTGCCTCTGGTTGGGCAGGTG
GCGTCGTTTACGGCAACGTTGAGTGCGAGCATTGCGGCGCTGGATGCCACTTGGAGGGCGCAGAGCGATGTGGGC
GTCACGGAAGACCTGGGCTGCCACATGCTCGACATGGTCGTCTCCCTCTTTGGCCAGCCCACCGCCGTCGCCGCG
CAAAACACAAAGGGCGTGCGCGCCGAACAAGCCTATGGCGGCGACGACGTGTCCAACATCATTATGAATTTCGGC
CCCGCCGCCAAACACACCATGGGCCACGTTCATCTCTCGCGCGTCGCCCACCGCGAGCAAGAGTCGCTCGTCATT
ACCGGCACAAAGGGCACCTTTGCCCTCGAGGGCCGCGACGTGCGTCTGCGCGACAGCGCCGGCAACGAAACCTTT
TCGCTGCACGACACCTCGGCAAAGACGTACGTGGTGCAGTCCATGCTGCATGCCTTTTCCGCCTGGATCACGGGC
ACAGAGCCAGACTTTTGCTGCGCAGTGGCCAACTTGAAAAACACGGTGCATGTCATGGACCAGGTTCGCGGCGCC
TACGCAAAGTCGCGCGCCACGGATGCCCTCTCAAGTCTCTCACTCCAGGCCGAGCCTCGCCTTGGTGCCTCGCTT
CAGGGCGCTCACCATGTCTGGCCCCTCTTGTCGGCAGAGTCGGAAGACGCCGTTGTGCGCCAGATGCACTCTTCC
CTCTCCATCTACAACCGCTCCGACATTTACCAAGTCTTTGAGGACCGCTGGCGCTCAATGCACAGCCTCAAGCAC
GCCCTCGTCTGCAGCTCCGGCACCGTGGCTATTCTGCACATGTTTGAGGCGCTGGATCTGCGGCCGGGCGACCAA
GTCTTGTGTCCCGTCTACACCTTTTTCGCCACCGCCTCGCCCCTGCTGCAGTATGGCGCCGTGCCCGTCTTTTGC
GACTCGCTCGACGACGGGAACCTCGACCCGGCCGAGATTTTGAAGCGCTCCACTGCTCGCACAAGAGCCGTCATT
GTCACCCACATGTGGGGGCTGCCCTGCCGCATGCAAGAAATTCTTCATAATGCTCGCAAGGTGGGCATCAAGGTG
CTCGAGGATTGCTCCCATGCCCACGGCGCCATGGTCAATGGCAAGCTTGTTGGCTCTTGGGGCGACATGGCCGCC
TGGTCCTTGCAGGCCAAGAAGAATGTCATGGGCGGCCAGGCCGGCGTCATGGCCACAAACTCGACCGACTACTAC
TCTCGCGCCGTCCTTCACGGCCACTTTAACAAGCGTGCCAAGGAGGATGTGCCAGCAGACCACTCGCTGCGAAAG
TTTTGGCTCACCGGCCTCGGCCTCAACCTCCGCGCCCACCCCCTCGCCATTGCCCTCGCCAACCAACAAGCCAAC
CTCCTCCCCACCCACGACCACAACCGCCAAACCTACGCCTCCTACATGGCCACCCGCCTCGCCGCCATTCCCTTT
CTCAAAATGCCCGTCGTCCACGACACCCAGCACGACAAGCACGCCTGGTACGCCTTTGTCATGCAATTCGACGCC
ACCAAGGCTCCCCCTGGCCTCTCGCGCGATGACTTTGTCGCCAAGCTTGTCGACGAGCACGGCCTCTCTGAGGTC
GACATCCCACGCTCCACGGGCCTCTTAAACGAGCTGCCGCTCTTTACCCACTCGCACGAGGCCATTCCTAGATTT
GGAAACGAGCCTTGGGGTCAAGTCCAGCCTACTACGCAGTTTCCGCGCGCTGATGCCTTTTTCAAGGCTGCCATC
AAGTTGCCTGTTTGGGCCACCAAGGCTGACGAGCATATTGTCAAGCACTACGTTGAAAAGTTTTTGCTTGTGGCT
CGTGAGTGTTTGCAAGCCTCAGAGGGGCCCAAGGATGGCAAGACGAGCTTGAGCGAGCGTGTACATGCCAGATTG
TAG
Gene >OphauB2|1764
ATGGACGGTGTTGGTTCACGGCCTCCGCTCAAAGTGGCCATTATCGGGATTGGCCACCGCGGCTACAAGACGCAT
TTCCTATCCATTTTGGAAAATCCGCGGGCATGGAAAGTGGTGGCCGTGTGCGACACGAGCGACGAGGCGCGGGCG
CGCTTTGCCAGCCAGCACCGCGGCATCAGCACCCATGGCAGCCACGACGAGTTGCTGGCGCAGCACAAGACGAGC
CTCGACTTTGCCATTGTGTGTCTGCCGCACGAGCACCACTTGGCGTGCTGTGAGGCGCTGGCGCGGGCGGGCGTG
CCGGTGCTAAAGGAGAAGCCCGTGGCCGAGTCGGCAGACGAGTATGAGCGGCTGGCGAGGCTGCCGGTAAAGATT
GGCGTGTGTTTTCAAAAGAGGTTTGAGCCTCGCTATTTGGCGGTGAGGGATTTGCTGCCTCTGGTTGGGCAGGTG
GCGTCGTTTACGGCAACGTTGAGTGCGAGCATTGCGGCGCTGGATGCCACTTGGAGGGCGCAGAGCGATGTGGGC
GTCACGGCAAGTCTTTTTGTCCTTATCCACACATTGCTCTCCTTGGTCACACATTGCTGCTTCCCTTTCCTTGGC
CACACACTACTGCTCTTCTCCTTGGTCACATATTGCTGCTTGAATATGTGTCCTTTTCGAGTCCTCATGGCTTCC
CCTCTTGGCCACACATTGCTGCCTTTGCTGCTTCCCCTATAGACCCCCAAGGCTAACACTCATCCAGGAAGACCT
GGGCTGCCACATGCTCGACATGGTCGTCTCCCTCTTTGGCCAGCCCACCGCCGTCGCCGCGCAAAACACAAAGGG
CGTGCGCGCCGAACAAGCCTATGGCGGCGACGACGTGTCCAACATCATTATGAATTTCGGCCCCGCCGCCAAACA
CACCATGGGCCACGTTCATCTCTCGCGCGTCGCCCACCGCGAGCAAGAGTCGCTCGTCATTACCGGCACAAAGGG
CACCTTTGCCCTCGAGGGCCGCGACGTGCGTCTGCGCGACAGCGCCGGCAACGAAACCTTTTCGCTGCACGACAC
CTCGGCAAAGACGTACGTGGTGCAGTCCATGCTGCATGCCTTTTCCGCCTGGATCACGGGCACAGAGCCAGACTT
TTGCTGCGCAGTGGCCAACTTGAAAAACACGGTGCATGTCATGGACCAGGTTCGCGGCGCCTACGCAAAGTCGCG
CGCCACGGATGCCCTCTCAAGTCTCTCACTCCAGGCCGAGCCTCGCCTTGGTGCCTCGCTTCAGGGCGCTCACCA
TGTCTGGCCCCTCTTGTCGGCAGAGTCGGAAGACGCCGTTGTGCGCCAGATGCACTCTTCCCTCTCCATCTACAA
CCGCTCCGACATTTACCAAGTCTTTGAGGACCGCTGGCGCTCAATGCACAGCCTCAAGCACGCCCTCGTCTGCAG
CTCCGGCACCGTGGCTATTCTGCACATGTTTGAGGCGCTGGATCTGCGGCCGGGCGACCAAGTCTTGTGTCCCGT
CTACACCTTTTTCGCCACCGCCTCGCCCCTGCTGCAGTATGGCGCCGTGCCCGTCTTTTGCGACTCGCTCGACGA
CGGGAACCTCGACCCGGCCGAGATTTTGAAGCGCTCCACTGCTCGCACAAGAGCCGTCATTGTCACCCACATGTG
GGGGCTGCCCTGCCGCATGCAAGAAATTCTTCATAATGCTCGCAAGGTGGGCATCAAGGTGCTCGAGGATTGCTC
CCATGCCCACGGCGCCATGGTCAATGGCAAGCTTGTTGGCTCTTGGGGCGACATGGCCGCCTGGTCCTTGCAGGC
CAAGAAGAATGTCATGGGCGGCCAGGCCGGCGTCATGGCCACAAACTCGACCGACTACTACTCTCGCGCCGTCCT
TCACGGCCACTTTAACAAGCGTGCCAAGGAGGATGTGCCAGCAGACCACTCGCTGCGAAAGTTTTGGCGTATGTT
TTTTTTCTTTTTTTTTTCCCCTCTCCTACCACTCTCTCCATCACTCTGCATCACTCTCACTCTCCCTACCACTCT
CTACTCTTCCCCCCCCTCTCCCCCCCGTGCTCTATATGGCTAACAAACCAAGTCACCGGCCTCGGCCTCAACCTC
CGCGCCCACCCCCTCGCCATTGCCCTCGCCAACCAACAAGCCAACCTCCTCCCCACCCACGACCACAACCGCCAA
ACCTACGCCTCCTACATGGCCACCCGCCTCGCCGCCATTCCCTTTCTCAAAATGCCCGTCGTCCACGACACCCAG
CACGACAAGCACGCCTGGTACGCCTTTGTCATGCAATTCGACGCCACCAAGGCTCCCCCTGGCCTCTCGCGCGAT
GACTTTGTCGCCAAGCTTGTCGACGAGCACGGCCTCTCTGAGGTCGACATCCCACGCTCCACGGGCCTCTTAAAC
GAGCTGCCGCTCTTTACCCACTCGCACGAGGCCATTCCTAGATTTGGAAACGAGCCTTGGGGTCAAGTCCAGCCT
ACTACGCAGTTTCCGCGCGCTGATGCCTTTTTCAAGGCTGCCATCAAGTTGCCTGTTTGGGCCACCAAGGCTGAC
GAGCATATTGTCAAGCACTACGTTGAAAAGTTTTTGCTTGTGGCTCGTGAGTGTTTGCAAGCCTCAGAGGGGCCC
AAGGATGGCAAGACGAGCTTGAGCGAGCGTGTACATGCCAGATTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail