Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1763
Gene name
LocationContig_15:148328..149102
Strand+
Gene length (bp)774
Transcript length (bp)774
Coding sequence length (bp)774
Protein length (aa) 258

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 9.5E-15 46 147
PF08241 Methyltransf_11 Methyltransferase domain 3.5E-11 47 150
PF08242 Methyltransf_12 Methyltransferase domain 7.1E-10 47 149
PF05175 MTS Methyltransferase small domain 3.1E-08 42 150
PF13847 Methyltransf_31 Methyltransferase domain 5.9E-07 43 155
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 2.1E-05 5 151

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9I8S2|MCES_XENLA mRNA cap guanine-N7 methyltransferase OS=Xenopus laevis GN=rnmt PE=2 SV=1 32 152 1.0E-06
sp|Q8SR66|MCES_ENCCU mRNA cap guanine-N7 methyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ABD1 PE=1 SV=2 43 238 6.0E-06

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1763
MASVEKVKSEYDAQAEGYNDISHLPCNILESELIEVALGDCTGLNVLDFGGGSGLHARQAVDAGAACVDIIDLST
SMLRVAQETEKKLGRSGKIRCFEADVTKPLDHLGLREEYDLVMSNFCFDHATTHEQLEAMWRNAVSRLKPGGRFV
GARVGNMKSLACTSGIYGVTYKDFQDIPGGVRYRYRMNLTEPIEFEACSLLASYSGNTEMHKKFGLTDIDEVPFE
KSKAIRENPDFWKVFLDDPSMAVVMARKGVAV*
Coding >OphauB2|1763
ATGGCTAGCGTTGAAAAGGTGAAGAGCGAATACGATGCGCAAGCCGAAGGGTATAACGACATTTCACACCTGCCA
TGCAACATCCTGGAGTCGGAGCTAATCGAAGTGGCGCTGGGAGATTGCACGGGGCTCAACGTGCTGGACTTTGGC
GGCGGATCAGGCCTCCATGCTCGGCAAGCAGTGGATGCAGGGGCGGCATGCGTCGACATCATTGACCTATCGACG
TCGATGCTGCGCGTGGCGCAAGAGACTGAGAAGAAGCTTGGACGCAGCGGCAAGATTCGCTGCTTTGAAGCCGAC
GTGACAAAGCCACTGGACCACTTGGGCCTTCGCGAGGAATACGACCTTGTCATGTCCAACTTTTGCTTTGACCAC
GCCACAACGCACGAACAGCTAGAGGCCATGTGGCGCAACGCCGTGTCTCGTCTCAAGCCTGGTGGACGCTTCGTG
GGCGCGCGAGTCGGCAACATGAAGAGCCTGGCCTGCACATCGGGGATTTACGGAGTCACGTACAAGGATTTCCAA
GACATTCCCGGCGGAGTGCGCTATCGCTACCGCATGAACCTGACGGAGCCTATTGAGTTTGAGGCGTGTTCCCTG
CTGGCTAGCTACTCGGGCAACACGGAGATGCATAAAAAGTTTGGTCTGACGGACATTGACGAGGTGCCCTTTGAA
AAGTCCAAGGCGATTCGGGAGAATCCCGACTTTTGGAAGGTGTTTTTGGATGACCCGAGCATGGCGGTTGTGATG
GCGAGAAAGGGCGTGGCAGTTTGA
Transcript >OphauB2|1763
ATGGCTAGCGTTGAAAAGGTGAAGAGCGAATACGATGCGCAAGCCGAAGGGTATAACGACATTTCACACCTGCCA
TGCAACATCCTGGAGTCGGAGCTAATCGAAGTGGCGCTGGGAGATTGCACGGGGCTCAACGTGCTGGACTTTGGC
GGCGGATCAGGCCTCCATGCTCGGCAAGCAGTGGATGCAGGGGCGGCATGCGTCGACATCATTGACCTATCGACG
TCGATGCTGCGCGTGGCGCAAGAGACTGAGAAGAAGCTTGGACGCAGCGGCAAGATTCGCTGCTTTGAAGCCGAC
GTGACAAAGCCACTGGACCACTTGGGCCTTCGCGAGGAATACGACCTTGTCATGTCCAACTTTTGCTTTGACCAC
GCCACAACGCACGAACAGCTAGAGGCCATGTGGCGCAACGCCGTGTCTCGTCTCAAGCCTGGTGGACGCTTCGTG
GGCGCGCGAGTCGGCAACATGAAGAGCCTGGCCTGCACATCGGGGATTTACGGAGTCACGTACAAGGATTTCCAA
GACATTCCCGGCGGAGTGCGCTATCGCTACCGCATGAACCTGACGGAGCCTATTGAGTTTGAGGCGTGTTCCCTG
CTGGCTAGCTACTCGGGCAACACGGAGATGCATAAAAAGTTTGGTCTGACGGACATTGACGAGGTGCCCTTTGAA
AAGTCCAAGGCGATTCGGGAGAATCCCGACTTTTGGAAGGTGTTTTTGGATGACCCGAGCATGGCGGTTGTGATG
GCGAGAAAGGGCGTGGCAGTTTGA
Gene >OphauB2|1763
ATGGCTAGCGTTGAAAAGGTGAAGAGCGAATACGATGCGCAAGCCGAAGGGTATAACGACATTTCACACCTGCCA
TGCAACATCCTGGAGTCGGAGCTAATCGAAGTGGCGCTGGGAGATTGCACGGGGCTCAACGTGCTGGACTTTGGC
GGCGGATCAGGCCTCCATGCTCGGCAAGCAGTGGATGCAGGGGCGGCATGCGTCGACATCATTGACCTATCGACG
TCGATGCTGCGCGTGGCGCAAGAGACTGAGAAGAAGCTTGGACGCAGCGGCAAGATTCGCTGCTTTGAAGCCGAC
GTGACAAAGCCACTGGACCACTTGGGCCTTCGCGAGGAATACGACCTTGTCATGTCCAACTTTTGCTTTGACCAC
GCCACAACGCACGAACAGCTAGAGGCCATGTGGCGCAACGCCGTGTCTCGTCTCAAGCCTGGTGGACGCTTCGTG
GGCGCGCGAGTCGGCAACATGAAGAGCCTGGCCTGCACATCGGGGATTTACGGAGTCACGTACAAGGATTTCCAA
GACATTCCCGGCGGAGTGCGCTATCGCTACCGCATGAACCTGACGGAGCCTATTGAGTTTGAGGCGTGTTCCCTG
CTGGCTAGCTACTCGGGCAACACGGAGATGCATAAAAAGTTTGGTCTGACGGACATTGACGAGGTGCCCTTTGAA
AAGTCCAAGGCGATTCGGGAGAATCCCGACTTTTGGAAGGTGTTTTTGGATGACCCGAGCATGGCGGTTGTGATG
GCGAGAAAGGGCGTGGCAGTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail