Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1755
Gene name
LocationContig_15:123648..127369
Strand-
Gene length (bp)3721
Transcript length (bp)3603
Coding sequence length (bp)3603
Protein length (aa) 1201

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.7E-07 1084 1150
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.7E-08 1104 1195
PF13637 Ank_4 Ankyrin repeats (many copies) 2.7E-06 1104 1149
PF00023 Ank Ankyrin repeat 2.8E-04 1128 1159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 1099 1198 6.0E-07
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 1099 1198 2.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 1099 1198 3.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 1099 1198 3.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 1099 1198 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 1099 1198 6.0E-07
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 1099 1198 2.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 1099 1198 3.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 1099 1198 3.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 1099 1198 3.0E-06
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 1099 1198 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup84
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1577
Ophiocordyceps australis 1348a (Ghana) OphauG2|2943
Ophiocordyceps australis 1348a (Ghana) OphauG2|5919
Ophiocordyceps australis map64 (Brazil) OphauB2|1448
Ophiocordyceps australis map64 (Brazil) OphauB2|1752
Ophiocordyceps australis map64 (Brazil) OphauB2|1755 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2666
Ophiocordyceps australis map64 (Brazil) OphauB2|4190
Ophiocordyceps australis map64 (Brazil) OphauB2|4691
Ophiocordyceps australis map64 (Brazil) OphauB2|4872
Ophiocordyceps australis map64 (Brazil) OphauB2|5124
Ophiocordyceps australis map64 (Brazil) OphauB2|7730
Ophiocordyceps kimflemingae Ophio5|7512
Ophiocordyceps subramaniannii Hirsu2|1991
Ophiocordyceps subramaniannii Hirsu2|4897
Ophiocordyceps subramaniannii Hirsu2|7175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1755
MEEDEILTRYFVERPSSAWSSIEQIIVAAGVDSPTPEIEANIKQRIQEHPDILAQTVSFLSDDFDTEEYEPPIKK
AKAQEVTEVEPILASNEPQSGSEESQSAPEKSNPSLEESNPSLEESNPSSEESQSASEKSNPSLEESNLSSEESN
PSSEESQSAPEKSQSASEKSNQSSEESNPSSEDPLSSLFSDDLDRLSGDGYHDGYQDPSFPGAGIAFKKPQRGQF
DDSVDRVLLTDYQSPSKSLKDDLPTGSAVPTSPLDETSSDVVMTENPNSFSKNSVPPLSDTPLPEAESSSTRGLG
LENRFDTLTLDITNTPVSLKSPDITESIKNGRHSKIPESINESLASLRLQGLPETDRISKTLSTDELPKTPEAHT
FSGNPDIDKMMRSNERANTPGLLKSDGIPKGLGPKTKSDEAVVSSDPQAPRNLDHEMIKYGDELGSEWDLPTDEE
LESPKPLGRAVAKSKQSAASDTSSVNLRRQGKTLKYIGEGISPSNWEMRDRLTTDEMTDLVEKVVESDYELDFDV
FDNIEPSLSESSIGKSFPQSVKNRQEKTGKSLASEAETLHKMDPPRLGLKGNDQISGAGPSKENFKQKATMDRVS
QMSPVPEEKVASHKSRPKSRDQETPTRDGRPDRNPKHRGGRNRGRKRKNRTRTHSSTKNQKVAVACCAPGGAGSL
RKRDCIPCPPEVKSRPRPQLDPAKTEKNAAMSKSKPDDMAKGANLQQLADRKAAAEFRNLARKLKLPIKTDEVSL
AILRARFKQSSQGLGNFMQRWGPLTFFGATALPLYVTNLVKTIQNGASKDATYNAAVSIIPIAGCSSQLLTDLKY
NRQSVAASTANVLCFAGDFLLFTPWLPIGIALHAIRGAFTSLELLSKEVMLSRRDTAWGQHYQEMLRQSQSQDSI
HKVKLWYTEEIANITFQVSEERGMLAAAQSLSQSTIDTTKQPEAEAIISEQYNKTEQTLCASIRDRRLRVLMALP
NTKWVDDQAAKFQNSFMKNYEDEAEERHLMTPEKYSFVAHGMPVFDSSLLRSSERRRYEALVSPIRRYLHSNNLD
TKKFEFVKQIRSHFNSVLFVPSQCSCPTNVNELETIKALEVNGDELEHALRCSAANGNADMVQKILALGTNINVK
SKNGNTPLMLAAMHGHKDAVEKLLGLSKDVFANVLRKTNSIDLNVRNNKGQTAQALAKKNGHDKVLKILKKAAGK
*
Coding >OphauB2|1755
ATGGAGGAAGACGAGATCCTGACACGGTATTTTGTGGAACGTCCAAGTTCGGCGTGGAGCTCTATTGAGCAGATT
ATTGTCGCGGCTGGTGTTGATTCTCCAACCCCAGAAATTGAAGCAAACATCAAACAACGCATCCAGGAGCATCCA
GATATCCTGGCGCAAACCGTTAGTTTTTTGTCTGACGACTTTGACACCGAGGAGTACGAACCACCAATCAAAAAG
GCAAAAGCACAGGAAGTAACTGAAGTGGAGCCAATTCTGGCCTCGAATGAGCCACAATCAGGCTCAGAAGAGTCA
CAATCAGCTCCAGAGAAGTCAAACCCATCTTTAGAAGAGTCAAACCCATCTTTAGAAGAGTCAAACCCATCTTCA
GAAGAGTCACAATCAGCTTCAGAGAAGTCAAACCCATCTTTAGAAGAGTCAAACCTATCTTCAGAAGAGTCAAAC
CCATCTTCAGAAGAGTCACAGTCAGCTCCAGAGAAGTCACAATCAGCTTCAGAGAAGTCAAATCAATCTTCAGAA
GAGTCAAACCCATCTTCAGAGGACCCATTATCGTCATTATTTTCCGATGACTTGGATCGATTATCTGGTGATGGT
TATCATGACGGTTACCAAGATCCGTCGTTTCCGGGTGCAGGCATTGCTTTTAAAAAGCCCCAGCGAGGGCAATTC
GATGACTCAGTGGATCGTGTTTTGCTTACAGATTATCAAAGCCCCAGCAAGTCTTTGAAAGATGACCTTCCTACT
GGGTCTGCTGTGCCAACGTCGCCTCTTGATGAAACATCATCAGATGTCGTTATGACTGAGAATCCAAATTCGTTT
TCTAAAAATTCGGTGCCGCCCCTTTCCGATACTCCTCTACCAGAAGCGGAGAGTTCATCGACAAGAGGGCTTGGT
CTTGAGAATCGTTTCGATACTTTAACCTTGGATATTACGAATACTCCCGTTTCCCTTAAGAGTCCCGATATTACT
GAATCTATCAAGAATGGGAGACACTCGAAAATTCCTGAATCTATCAATGAGTCTCTCGCGAGTCTAAGGCTTCAA
GGGCTTCCGGAGACTGATAGGATCTCCAAGACTCTAAGCACTGATGAGCTTCCAAAGACTCCAGAGGCTCATACA
TTTTCCGGAAACCCGGACATTGATAAGATGATGCGAAGTAATGAGCGTGCAAATACTCCAGGCTTACTTAAATCT
GACGGTATTCCTAAAGGCCTTGGACCTAAGACAAAATCTGATGAAGCTGTCGTTTCATCTGACCCCCAAGCACCA
CGAAATCTTGATCACGAGATGATCAAGTATGGGGACGAACTGGGCTCCGAGTGGGATCTACCAACTGATGAAGAG
CTTGAGAGCCCCAAGCCCCTGGGCAGAGCTGTGGCCAAGAGTAAGCAGAGCGCAGCAAGCGACACTTCCAGCGTT
AATTTACGTCGACAAGGAAAGACACTTAAATATATAGGAGAAGGGATATCGCCGAGTAACTGGGAAATGCGGGAC
CGGTTGACTACGGATGAGATGACGGACCTGGTTGAAAAAGTCGTTGAGAGCGACTATGAGCTTGATTTCGATGTC
TTTGACAATATTGAGCCGTCATTGTCTGAGAGCTCTATTGGCAAGTCTTTCCCCCAGTCTGTGAAGAATAGGCAA
GAAAAAACAGGCAAAAGCTTGGCGTCCGAAGCCGAGACTCTACACAAGATGGATCCGCCACGGCTAGGTCTGAAA
GGAAACGATCAAATTTCTGGGGCAGGACCGAGCAAAGAAAATTTTAAACAAAAAGCAACGATGGATAGAGTTAGT
CAAATGTCGCCTGTCCCGGAAGAAAAGGTCGCAAGCCATAAATCACGCCCCAAATCCAGAGACCAAGAAACGCCA
ACAAGAGATGGGCGCCCCGATAGGAATCCAAAACACAGAGGCGGGAGAAACCGTGGCCGGAAAAGAAAGAATCGA
ACGAGAACTCACTCAAGCACCAAAAATCAAAAGGTGGCAGTTGCTTGCTGTGCACCAGGCGGAGCCGGGTCTCTC
CGCAAGAGGGATTGTATTCCGTGTCCACCAGAGGTTAAAAGCCGACCACGACCACAACTCGATCCCGCAAAGACA
GAGAAGAATGCCGCCATGTCAAAGAGCAAGCCTGATGACATGGCCAAGGGGGCAAATTTGCAGCAGTTGGCCGAC
AGAAAGGCAGCAGCAGAGTTTCGAAATCTGGCGCGCAAGCTTAAGCTCCCGATAAAAACCGACGAAGTATCTCTG
GCCATACTTCGAGCCAGGTTCAAACAATCGTCGCAAGGCCTTGGAAATTTTATGCAGAGATGGGGCCCCTTGACT
TTCTTTGGGGCTACCGCTCTGCCGCTGTACGTGACCAACTTGGTGAAAACGATTCAAAACGGCGCATCCAAGGAC
GCCACGTATAATGCAGCGGTATCGATTATACCCATTGCTGGCTGCTCATCTCAGCTGTTGACCGACTTGAAGTAT
AACAGACAAAGCGTTGCTGCAAGCACGGCTAATGTGCTTTGCTTTGCTGGCGATTTTCTCCTCTTTACGCCGTGG
CTACCTATAGGAATAGCCCTACATGCAATAAGAGGAGCCTTTACGTCTTTGGAGTTGCTGAGCAAAGAAGTCATG
CTGAGCCGGCGCGACACTGCTTGGGGACAGCACTATCAAGAGATGCTTCGGCAATCCCAGTCCCAAGATTCCATT
CACAAGGTCAAACTATGGTATACTGAGGAGATTGCAAACATAACGTTTCAAGTATCCGAAGAGAGGGGCATGCTC
GCTGCGGCTCAGTCTTTGAGTCAATCCACGATCGATACTACCAAACAGCCTGAAGCAGAAGCCATCATTTCGGAA
CAGTATAACAAGACGGAACAGACTCTATGTGCCAGCATCAGAGATAGGAGACTTCGGGTGCTCATGGCTCTCCCC
AACACAAAATGGGTAGATGACCAGGCTGCGAAGTTTCAAAACAGCTTTATGAAGAATTACGAAGACGAGGCAGAA
GAAAGGCACCTGATGACGCCTGAAAAGTATTCGTTCGTGGCACATGGAATGCCTGTGTTTGATAGTTCGCTTCTT
CGGAGCTCTGAGCGAAGAAGATATGAGGCATTGGTTTCACCTATCCGCAGGTATCTCCACAGCAACAATTTGGAT
ACGAAGAAATTCGAGTTTGTCAAGCAAATAAGATCTCACTTTAATAGTGTTCTCTTCGTCCCCTCGCAGTGCAGC
TGTCCCACTAATGTCAATGAACTTGAAACAATCAAGGCTCTTGAAGTTAATGGCGACGAGCTGGAACATGCGCTT
CGATGCTCAGCGGCCAACGGCAACGCCGACATGGTGCAAAAAATCTTGGCCTTGGGGACCAACATCAACGTTAAG
AGCAAGAATGGAAATACTCCACTCATGTTGGCGGCAATGCATGGGCATAAAGACGCTGTTGAGAAGCTTCTCGGC
TTATCGAAGGATGTTTTTGCCAACGTGTTGAGAAAAACCAACTCCATCGACTTGAACGTTCGCAATAACAAGGGA
CAGACGGCGCAAGCACTAGCAAAGAAGAATGGCCATGACAAGGTTCTGAAAATTCTTAAAAAGGCGGCCGGCAAG
TAG
Transcript >OphauB2|1755
ATGGAGGAAGACGAGATCCTGACACGGTATTTTGTGGAACGTCCAAGTTCGGCGTGGAGCTCTATTGAGCAGATT
ATTGTCGCGGCTGGTGTTGATTCTCCAACCCCAGAAATTGAAGCAAACATCAAACAACGCATCCAGGAGCATCCA
GATATCCTGGCGCAAACCGTTAGTTTTTTGTCTGACGACTTTGACACCGAGGAGTACGAACCACCAATCAAAAAG
GCAAAAGCACAGGAAGTAACTGAAGTGGAGCCAATTCTGGCCTCGAATGAGCCACAATCAGGCTCAGAAGAGTCA
CAATCAGCTCCAGAGAAGTCAAACCCATCTTTAGAAGAGTCAAACCCATCTTTAGAAGAGTCAAACCCATCTTCA
GAAGAGTCACAATCAGCTTCAGAGAAGTCAAACCCATCTTTAGAAGAGTCAAACCTATCTTCAGAAGAGTCAAAC
CCATCTTCAGAAGAGTCACAGTCAGCTCCAGAGAAGTCACAATCAGCTTCAGAGAAGTCAAATCAATCTTCAGAA
GAGTCAAACCCATCTTCAGAGGACCCATTATCGTCATTATTTTCCGATGACTTGGATCGATTATCTGGTGATGGT
TATCATGACGGTTACCAAGATCCGTCGTTTCCGGGTGCAGGCATTGCTTTTAAAAAGCCCCAGCGAGGGCAATTC
GATGACTCAGTGGATCGTGTTTTGCTTACAGATTATCAAAGCCCCAGCAAGTCTTTGAAAGATGACCTTCCTACT
GGGTCTGCTGTGCCAACGTCGCCTCTTGATGAAACATCATCAGATGTCGTTATGACTGAGAATCCAAATTCGTTT
TCTAAAAATTCGGTGCCGCCCCTTTCCGATACTCCTCTACCAGAAGCGGAGAGTTCATCGACAAGAGGGCTTGGT
CTTGAGAATCGTTTCGATACTTTAACCTTGGATATTACGAATACTCCCGTTTCCCTTAAGAGTCCCGATATTACT
GAATCTATCAAGAATGGGAGACACTCGAAAATTCCTGAATCTATCAATGAGTCTCTCGCGAGTCTAAGGCTTCAA
GGGCTTCCGGAGACTGATAGGATCTCCAAGACTCTAAGCACTGATGAGCTTCCAAAGACTCCAGAGGCTCATACA
TTTTCCGGAAACCCGGACATTGATAAGATGATGCGAAGTAATGAGCGTGCAAATACTCCAGGCTTACTTAAATCT
GACGGTATTCCTAAAGGCCTTGGACCTAAGACAAAATCTGATGAAGCTGTCGTTTCATCTGACCCCCAAGCACCA
CGAAATCTTGATCACGAGATGATCAAGTATGGGGACGAACTGGGCTCCGAGTGGGATCTACCAACTGATGAAGAG
CTTGAGAGCCCCAAGCCCCTGGGCAGAGCTGTGGCCAAGAGTAAGCAGAGCGCAGCAAGCGACACTTCCAGCGTT
AATTTACGTCGACAAGGAAAGACACTTAAATATATAGGAGAAGGGATATCGCCGAGTAACTGGGAAATGCGGGAC
CGGTTGACTACGGATGAGATGACGGACCTGGTTGAAAAAGTCGTTGAGAGCGACTATGAGCTTGATTTCGATGTC
TTTGACAATATTGAGCCGTCATTGTCTGAGAGCTCTATTGGCAAGTCTTTCCCCCAGTCTGTGAAGAATAGGCAA
GAAAAAACAGGCAAAAGCTTGGCGTCCGAAGCCGAGACTCTACACAAGATGGATCCGCCACGGCTAGGTCTGAAA
GGAAACGATCAAATTTCTGGGGCAGGACCGAGCAAAGAAAATTTTAAACAAAAAGCAACGATGGATAGAGTTAGT
CAAATGTCGCCTGTCCCGGAAGAAAAGGTCGCAAGCCATAAATCACGCCCCAAATCCAGAGACCAAGAAACGCCA
ACAAGAGATGGGCGCCCCGATAGGAATCCAAAACACAGAGGCGGGAGAAACCGTGGCCGGAAAAGAAAGAATCGA
ACGAGAACTCACTCAAGCACCAAAAATCAAAAGGTGGCAGTTGCTTGCTGTGCACCAGGCGGAGCCGGGTCTCTC
CGCAAGAGGGATTGTATTCCGTGTCCACCAGAGGTTAAAAGCCGACCACGACCACAACTCGATCCCGCAAAGACA
GAGAAGAATGCCGCCATGTCAAAGAGCAAGCCTGATGACATGGCCAAGGGGGCAAATTTGCAGCAGTTGGCCGAC
AGAAAGGCAGCAGCAGAGTTTCGAAATCTGGCGCGCAAGCTTAAGCTCCCGATAAAAACCGACGAAGTATCTCTG
GCCATACTTCGAGCCAGGTTCAAACAATCGTCGCAAGGCCTTGGAAATTTTATGCAGAGATGGGGCCCCTTGACT
TTCTTTGGGGCTACCGCTCTGCCGCTGTACGTGACCAACTTGGTGAAAACGATTCAAAACGGCGCATCCAAGGAC
GCCACGTATAATGCAGCGGTATCGATTATACCCATTGCTGGCTGCTCATCTCAGCTGTTGACCGACTTGAAGTAT
AACAGACAAAGCGTTGCTGCAAGCACGGCTAATGTGCTTTGCTTTGCTGGCGATTTTCTCCTCTTTACGCCGTGG
CTACCTATAGGAATAGCCCTACATGCAATAAGAGGAGCCTTTACGTCTTTGGAGTTGCTGAGCAAAGAAGTCATG
CTGAGCCGGCGCGACACTGCTTGGGGACAGCACTATCAAGAGATGCTTCGGCAATCCCAGTCCCAAGATTCCATT
CACAAGGTCAAACTATGGTATACTGAGGAGATTGCAAACATAACGTTTCAAGTATCCGAAGAGAGGGGCATGCTC
GCTGCGGCTCAGTCTTTGAGTCAATCCACGATCGATACTACCAAACAGCCTGAAGCAGAAGCCATCATTTCGGAA
CAGTATAACAAGACGGAACAGACTCTATGTGCCAGCATCAGAGATAGGAGACTTCGGGTGCTCATGGCTCTCCCC
AACACAAAATGGGTAGATGACCAGGCTGCGAAGTTTCAAAACAGCTTTATGAAGAATTACGAAGACGAGGCAGAA
GAAAGGCACCTGATGACGCCTGAAAAGTATTCGTTCGTGGCACATGGAATGCCTGTGTTTGATAGTTCGCTTCTT
CGGAGCTCTGAGCGAAGAAGATATGAGGCATTGGTTTCACCTATCCGCAGGTATCTCCACAGCAACAATTTGGAT
ACGAAGAAATTCGAGTTTGTCAAGCAAATAAGATCTCACTTTAATAGTGTTCTCTTCGTCCCCTCGCAGTGCAGC
TGTCCCACTAATGTCAATGAACTTGAAACAATCAAGGCTCTTGAAGTTAATGGCGACGAGCTGGAACATGCGCTT
CGATGCTCAGCGGCCAACGGCAACGCCGACATGGTGCAAAAAATCTTGGCCTTGGGGACCAACATCAACGTTAAG
AGCAAGAATGGAAATACTCCACTCATGTTGGCGGCAATGCATGGGCATAAAGACGCTGTTGAGAAGCTTCTCGGC
TTATCGAAGGATGTTTTTGCCAACGTGTTGAGAAAAACCAACTCCATCGACTTGAACGTTCGCAATAACAAGGGA
CAGACGGCGCAAGCACTAGCAAAGAAGAATGGCCATGACAAGGTTCTGAAAATTCTTAAAAAGGCGGCCGGCAAG
TAG
Gene >OphauB2|1755
ATGGAGGAAGACGAGATCCTGACACGGTGTACGCATTTCTTCTGCTCCTCCTTTCCATGCCTCGTGCAAATGCTC
ATGCTGAAGATTAGATTTTGTGGAACGTCCAAGTTCGGCGTGGAGCTCTATTGAGCAGATTATTGTCGCGGCTGG
TGTTGATTCTCCAACCCCAGAAATTGAAGCAAACATCAAACAACGTAAGGCGTCAAAGAAATCAAATTTACGGGA
AAATTTACTAATATTTTTTAACATAGGCATCCAGGAGCATCCAGATATCCTGGCGCAAACCGTTAGTTTTTTGTC
TGACGACTTTGACACCGAGGAGTACGAACCACCAATCAAAAAGGCAAAAGCACAGGAAGTAACTGAAGTGGAGCC
AATTCTGGCCTCGAATGAGCCACAATCAGGCTCAGAAGAGTCACAATCAGCTCCAGAGAAGTCAAACCCATCTTT
AGAAGAGTCAAACCCATCTTTAGAAGAGTCAAACCCATCTTCAGAAGAGTCACAATCAGCTTCAGAGAAGTCAAA
CCCATCTTTAGAAGAGTCAAACCTATCTTCAGAAGAGTCAAACCCATCTTCAGAAGAGTCACAGTCAGCTCCAGA
GAAGTCACAATCAGCTTCAGAGAAGTCAAATCAATCTTCAGAAGAGTCAAACCCATCTTCAGAGGACCCATTATC
GTCATTATTTTCCGATGACTTGGATCGATTATCTGGTGATGGTTATCATGACGGTTACCAAGATCCGTCGTTTCC
GGGTGCAGGCATTGCTTTTAAAAAGCCCCAGCGAGGGCAATTCGATGACTCAGTGGATCGTGTTTTGCTTACAGA
TTATCAAAGCCCCAGCAAGTCTTTGAAAGATGACCTTCCTACTGGGTCTGCTGTGCCAACGTCGCCTCTTGATGA
AACATCATCAGATGTCGTTATGACTGAGAATCCAAATTCGTTTTCTAAAAATTCGGTGCCGCCCCTTTCCGATAC
TCCTCTACCAGAAGCGGAGAGTTCATCGACAAGAGGGCTTGGTCTTGAGAATCGTTTCGATACTTTAACCTTGGA
TATTACGAATACTCCCGTTTCCCTTAAGAGTCCCGATATTACTGAATCTATCAAGAATGGGAGACACTCGAAAAT
TCCTGAATCTATCAATGAGTCTCTCGCGAGTCTAAGGCTTCAAGGGCTTCCGGAGACTGATAGGATCTCCAAGAC
TCTAAGCACTGATGAGCTTCCAAAGACTCCAGAGGCTCATACATTTTCCGGAAACCCGGACATTGATAAGATGAT
GCGAAGTAATGAGCGTGCAAATACTCCAGGCTTACTTAAATCTGACGGTATTCCTAAAGGCCTTGGACCTAAGAC
AAAATCTGATGAAGCTGTCGTTTCATCTGACCCCCAAGCACCACGAAATCTTGATCACGAGATGATCAAGTATGG
GGACGAACTGGGCTCCGAGTGGGATCTACCAACTGATGAAGAGCTTGAGAGCCCCAAGCCCCTGGGCAGAGCTGT
GGCCAAGAGTAAGCAGAGCGCAGCAAGCGACACTTCCAGCGTTAATTTACGTCGACAAGGAAAGACACTTAAATA
TATAGGAGAAGGGATATCGCCGAGTAACTGGGAAATGCGGGACCGGTTGACTACGGATGAGATGACGGACCTGGT
TGAAAAAGTCGTTGAGAGCGACTATGAGCTTGATTTCGATGTCTTTGACAATATTGAGCCGTCATTGTCTGAGAG
CTCTATTGGCAAGTCTTTCCCCCAGTCTGTGAAGAATAGGCAAGAAAAAACAGGCAAAAGCTTGGCGTCCGAAGC
CGAGACTCTACACAAGATGGATCCGCCACGGCTAGGTCTGAAAGGAAACGATCAAATTTCTGGGGCAGGACCGAG
CAAAGAAAATTTTAAACAAAAAGCAACGATGGATAGAGTTAGTCAAATGTCGCCTGTCCCGGAAGAAAAGGTCGC
AAGCCATAAATCACGCCCCAAATCCAGAGACCAAGAAACGCCAACAAGAGATGGGCGCCCCGATAGGAATCCAAA
ACACAGAGGCGGGAGAAACCGTGGCCGGAAAAGAAAGAATCGAACGAGAACTCACTCAAGCACCAAAAATCAAAA
GGTGGCAGTTGCTTGCTGTGCACCAGGCGGAGCCGGGTCTCTCCGCAAGAGGGATTGTATTCCGTGTCCACCAGA
GGTTAAAAGCCGACCACGACCACAACTCGATCCCGCAAAGACAGAGAAGAATGCCGCCATGTCAAAGAGCAAGCC
TGATGACATGGCCAAGGGGGCAAATTTGCAGCAGTTGGCCGACAGAAAGGCAGCAGCAGAGTTTCGAAATCTGGC
GCGCAAGCTTAAGCTCCCGATAAAAACCGACGAAGTATCTCTGGCCATACTTCGAGCCAGGTTCAAACAATCGTC
GCAAGGCCTTGGAAATTTTATGCAGAGATGGGGCCCCTTGACTTTCTTTGGGGCTACCGCTCTGCCGCTGTACGT
GACCAACTTGGTGAAAACGATTCAAAACGGCGCATCCAAGGACGCCACGTATAATGCAGCGGTATCGATTATACC
CATTGCTGGCTGCTCATCTCAGCTGTTGACCGACTTGAAGTATAACAGACAAAGCGTTGCTGCAAGCACGGCTAA
TGTGCTTTGCTTTGCTGGCGATTTTCTCCTCTTTACGCCGTGGCTACCTATAGGAATAGCCCTACATGCAATAAG
AGGAGCCTTTACGTCTTTGGAGTTGCTGAGCAAAGAAGTCATGCTGAGCCGGCGCGACACTGCTTGGGGACAGCA
CTATCAAGAGATGCTTCGGCAATCCCAGTCCCAAGATTCCATTCACAAGGTCAAACTATGGTATACTGAGGAGAT
TGCAAACATAACGTTTCAAGTATCCGAAGAGAGGGGCATGCTCGCTGCGGCTCAGTCTTTGAGTCAATCCACGAT
CGATACTACCAAACAGCCTGAAGCAGAAGCCATCATTTCGGAACAGTATAACAAGACGGAACAGACTCTATGTGC
CAGCATCAGAGATAGGAGACTTCGGGTGCTCATGGCTCTCCCCAACACAAAATGGGTAGATGACCAGGCTGCGAA
GTTTCAAAACAGCTTTATGAAGAATTACGAAGACGAGGCAGAAGAAAGGCACCTGATGACGCCTGAAAAGTATTC
GTTCGTGGCACATGGAATGCCTGTGTTTGATAGTTCGCTTCTTCGGAGCTCTGAGCGAAGAAGATATGAGGCATT
GGTTTCACCTATCCGCAGGTATCTCCACAGCAACAATTTGGATACGAAGAAATTCGAGTTTGTCAAGCAAATAAG
ATCTCACTTTAATAGTGTTCTCTTCGTCCCCTCGCAGTGCAGCTGTCCCACTAATGTCAATGAACTTGAAACAAT
CAAGGCTCTTGAAGTTAATGGCGACGAGCTGGAACATGCGCTTCGATGCTCAGCGGCCAACGGCAACGCCGACAT
GGTGCAAAAAATCTTGGCCTTGGGGACCAACATCAACGTTAAGAGCAAGAATGGAAATACTCCACTCATGTTGGC
GGCAATGCATGGGCATAAAGACGCTGTTGAGAAGCTTCTCGGCTTATCGAAGGATGTTTTTGCCAACGTGTTGAG
AAAAACCAACTCCATCGACTTGAACGTTCGCAATAACAAGGGACAGACGGCGCAAGCACTAGCAAAGAAGAATGG
CCATGACAAGGTTCTGAAAATTCTTAAAAAGGCGGCCGGCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail