Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1752
Gene name
LocationContig_15:116818..118375
Strand+
Gene length (bp)1557
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.5E-13 424 508
PF13637 Ank_4 Ankyrin repeats (many copies) 6.1E-12 453 507
PF00023 Ank Ankyrin repeat 2.0E-03 361 381
PF00023 Ank Ankyrin repeat 1.2E-04 454 485
PF00023 Ank Ankyrin repeat 4.9E-03 486 507
PF13857 Ank_5 Ankyrin repeats (many copies) 2.1E-07 449 494

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 331 512 2.0E-12
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 330 517 3.0E-10
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 336 508 3.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 330 517 8.0E-10
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 333 507 8.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 331 512 2.0E-12
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 330 517 3.0E-10
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 336 508 3.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 330 517 8.0E-10
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 333 507 8.0E-10
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 330 517 8.0E-10
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 333 507 1.0E-09
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 333 507 1.0E-09
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 333 507 1.0E-09
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 329 507 2.0E-09
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 317 517 2.0E-09
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 333 507 3.0E-09
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 361 507 4.0E-09
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 317 506 2.0E-08
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 327 518 3.0E-08
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 333 507 3.0E-08
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 316 518 4.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 333 507 4.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 316 518 5.0E-08
sp|Q1LZH7|KANK2_BOVIN KN motif and ankyrin repeat domain-containing protein 2 OS=Bos taurus GN=KANK2 PE=2 SV=1 359 513 6.0E-08
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 358 507 6.0E-08
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 316 518 6.0E-08
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 330 506 7.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 324 507 1.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 324 507 1.0E-07
sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 359 511 1.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 332 511 3.0E-07
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 360 513 3.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 333 516 4.0E-07
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 315 509 4.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 333 507 4.0E-07
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 311 508 5.0E-07
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 360 513 5.0E-07
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 315 507 5.0E-07
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 360 513 6.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 351 507 6.0E-07
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 336 507 6.0E-07
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 359 507 6.0E-07
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 351 517 7.0E-07
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 315 507 7.0E-07
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 315 507 8.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 324 507 8.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 324 507 8.0E-07
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 319 509 8.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 332 509 9.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 332 507 9.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 332 509 9.0E-07
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 333 507 1.0E-06
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 332 507 1.0E-06
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 336 509 1.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 332 507 1.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 336 507 2.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 336 507 2.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 336 507 2.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 329 507 2.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 330 507 2.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 359 509 2.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 332 507 2.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 333 507 2.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 330 515 2.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 333 508 2.0E-06
sp|Q63ZY3|KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=KANK2 PE=1 SV=1 359 513 3.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 336 507 3.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 351 511 3.0E-06
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 362 507 3.0E-06
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 359 507 3.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 406 509 4.0E-06
sp|Q8BX02|KANK2_MOUSE KN motif and ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Kank2 PE=1 SV=1 359 513 4.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 336 507 4.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 332 507 4.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 319 509 5.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 316 508 6.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 361 507 7.0E-06
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 336 509 7.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 323 507 8.0E-06
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 336 508 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1752
MRTVFLKRWPNLALWTKGLGPMAVATAALLPWYILNVKQAFTEANNALDRGGEVTAIIPGLGCWFRLVSDMEKNI
IHEPRRATSNSLCLIGDALLFTPLMPLGLIMRVVQAILDGMPLTKTVIEARDDAWNNEYQKLLDRFTSEEGKARL
EKSYSTEMAAIIFVTSEQRGLLAAADTVLLKNATTDKERAAVNRRVSEAHVATQRTMCARIQDLRQQFEKVLPRK
EWLYLRAAEFTQKYIEELEEEIKRRHVVSEGFVTSYQRTWYPGLSDMREFELLKTKLRWSAIMNAKGIEFASKVK
SIFDGIFAIPSECICADKENYANRPRQELEDALLCATANGYSDIVEWLNNWLLQPKMHDADGFTALMLAVKRGNV
AIVELLAQRAGSGLPASKAEAAQSLASKLKQDDIVALLQTEVKADALLSLASKEGRVGVVELFRKRAVAYVDLAN
SFNNTALMLAAMHGHQDMVRLLLETEAVNPRAQNNDGETALTLAAARGHEQIVSALLAAVDRKQKLEG*
Coding >OphauB2|1752
ATGCGTACCGTCTTTCTCAAACGATGGCCAAACTTGGCTCTGTGGACCAAGGGACTGGGTCCCATGGCAGTGGCA
ACCGCTGCGTTGCTACCGTGGTATATCCTCAATGTGAAGCAAGCATTTACCGAAGCCAACAACGCATTAGATCGG
GGCGGCGAGGTGACGGCAATCATTCCTGGACTTGGCTGCTGGTTCAGGCTAGTATCGGACATGGAAAAGAATATA
ATCCACGAGCCGCGGCGCGCAACAAGCAACAGTCTTTGCCTTATTGGCGACGCGCTTCTCTTCACGCCCTTGATG
CCCCTTGGCCTCATTATGCGAGTAGTGCAAGCCATTTTGGATGGAATGCCCTTGACCAAGACGGTAATTGAGGCC
CGTGACGATGCGTGGAATAATGAGTATCAGAAACTGCTCGATCGGTTCACGTCCGAGGAAGGAAAGGCTCGTCTT
GAGAAGTCATATTCGACTGAGATGGCTGCCATTATATTCGTCACATCAGAACAGAGAGGATTGCTGGCAGCGGCA
GATACGGTGTTGCTGAAAAATGCTACTACTGATAAAGAGCGGGCTGCAGTCAATCGCAGGGTGTCAGAGGCCCAT
GTTGCGACTCAACGAACAATGTGTGCTAGAATCCAGGACCTAAGGCAGCAATTCGAGAAGGTCTTGCCGAGAAAA
GAGTGGCTATACCTCCGGGCAGCCGAATTTACTCAAAAATATATAGAGGAACTCGAAGAAGAAATTAAGCGTCGT
CATGTCGTTTCAGAGGGCTTCGTTACTTCATATCAGCGTACCTGGTACCCGGGGCTGTCTGATATGAGGGAATTT
GAACTCCTCAAAACCAAACTACGATGGTCAGCCATCATGAACGCCAAGGGCATAGAGTTTGCCAGCAAGGTCAAA
TCTATTTTCGACGGGATATTTGCAATACCCAGCGAGTGTATATGTGCTGATAAAGAGAATTATGCTAATCGCCCA
CGCCAAGAGTTGGAAGACGCACTGTTGTGCGCGACAGCCAACGGATATTCAGACATTGTCGAATGGCTCAATAAC
TGGCTTTTGCAACCCAAAATGCACGACGCTGATGGATTCACAGCGCTCATGCTTGCAGTAAAGCGAGGCAATGTG
GCCATTGTTGAGCTACTCGCGCAGAGAGCGGGCTCAGGCCTGCCTGCAAGCAAGGCCGAGGCAGCGCAATCCCTG
GCATCGAAATTAAAACAAGATGACATTGTCGCCCTGCTTCAGACCGAGGTCAAGGCCGATGCCCTCCTGTCTCTT
GCGTCCAAGGAGGGACGCGTTGGCGTTGTCGAGCTGTTCCGAAAGAGGGCTGTCGCTTACGTGGACCTTGCCAAC
AGCTTCAACAACACAGCGCTCATGTTGGCAGCAATGCATGGCCATCAGGATATGGTTCGACTACTCCTAGAAACG
GAGGCAGTTAACCCGAGGGCTCAGAACAATGACGGGGAAACAGCGCTGACGCTGGCAGCTGCGAGAGGCCACGAG
CAAATCGTCTCGGCGCTTCTAGCGGCAGTCGACAGAAAACAGAAGCTGGAAGGATGA
Transcript >OphauB2|1752
ATGCGTACCGTCTTTCTCAAACGATGGCCAAACTTGGCTCTGTGGACCAAGGGACTGGGTCCCATGGCAGTGGCA
ACCGCTGCGTTGCTACCGTGGTATATCCTCAATGTGAAGCAAGCATTTACCGAAGCCAACAACGCATTAGATCGG
GGCGGCGAGGTGACGGCAATCATTCCTGGACTTGGCTGCTGGTTCAGGCTAGTATCGGACATGGAAAAGAATATA
ATCCACGAGCCGCGGCGCGCAACAAGCAACAGTCTTTGCCTTATTGGCGACGCGCTTCTCTTCACGCCCTTGATG
CCCCTTGGCCTCATTATGCGAGTAGTGCAAGCCATTTTGGATGGAATGCCCTTGACCAAGACGGTAATTGAGGCC
CGTGACGATGCGTGGAATAATGAGTATCAGAAACTGCTCGATCGGTTCACGTCCGAGGAAGGAAAGGCTCGTCTT
GAGAAGTCATATTCGACTGAGATGGCTGCCATTATATTCGTCACATCAGAACAGAGAGGATTGCTGGCAGCGGCA
GATACGGTGTTGCTGAAAAATGCTACTACTGATAAAGAGCGGGCTGCAGTCAATCGCAGGGTGTCAGAGGCCCAT
GTTGCGACTCAACGAACAATGTGTGCTAGAATCCAGGACCTAAGGCAGCAATTCGAGAAGGTCTTGCCGAGAAAA
GAGTGGCTATACCTCCGGGCAGCCGAATTTACTCAAAAATATATAGAGGAACTCGAAGAAGAAATTAAGCGTCGT
CATGTCGTTTCAGAGGGCTTCGTTACTTCATATCAGCGTACCTGGTACCCGGGGCTGTCTGATATGAGGGAATTT
GAACTCCTCAAAACCAAACTACGATGGTCAGCCATCATGAACGCCAAGGGCATAGAGTTTGCCAGCAAGGTCAAA
TCTATTTTCGACGGGATATTTGCAATACCCAGCGAGTGTATATGTGCTGATAAAGAGAATTATGCTAATCGCCCA
CGCCAAGAGTTGGAAGACGCACTGTTGTGCGCGACAGCCAACGGATATTCAGACATTGTCGAATGGCTCAATAAC
TGGCTTTTGCAACCCAAAATGCACGACGCTGATGGATTCACAGCGCTCATGCTTGCAGTAAAGCGAGGCAATGTG
GCCATTGTTGAGCTACTCGCGCAGAGAGCGGGCTCAGGCCTGCCTGCAAGCAAGGCCGAGGCAGCGCAATCCCTG
GCATCGAAATTAAAACAAGATGACATTGTCGCCCTGCTTCAGACCGAGGTCAAGGCCGATGCCCTCCTGTCTCTT
GCGTCCAAGGAGGGACGCGTTGGCGTTGTCGAGCTGTTCCGAAAGAGGGCTGTCGCTTACGTGGACCTTGCCAAC
AGCTTCAACAACACAGCGCTCATGTTGGCAGCAATGCATGGCCATCAGGATATGGTTCGACTACTCCTAGAAACG
GAGGCAGTTAACCCGAGGGCTCAGAACAATGACGGGGAAACAGCGCTGACGCTGGCAGCTGCGAGAGGCCACGAG
CAAATCGTCTCGGCGCTTCTAGCGGCAGTCGACAGAAAACAGAAGCTGGAAGGATGA
Gene >OphauB2|1752
ATGCGTACCGTCTTTCTCAAACGATGGCCAAACTTGGCTCTGTGGACCAAGGGACTGGGTCCCATGGCAGTGGCA
ACCGCTGCGTTGCTACCGTGGTATATCCTCAATGTGAAGCAAGCATTTACCGAAGCCAACAACGCATTAGATCGG
GGCGGCGAGGTGACGGCAATCATTCCTGGACTTGGCTGCTGGTTCAGGCTAGTATCGGACATGGAAAAGAATATA
ATCCACGAGCCGCGGCGCGCAACAAGCAACAGTCTTTGCCTTATTGGCGACGCGCTTCTCTTCACGCCCTTGATG
CCCCTTGGCCTCATTATGCGAGTAGTGCAAGCCATTTTGGATGGAATGCCCTTGACCAAGACGGTAATTGAGGCC
CGTGACGATGCGTGGAATAATGAGTATCAGAAACTGCTCGATCGGTTCACGTCCGAGGAAGGAAAGGCTCGTCTT
GAGAAGTCATATTCGACTGAGATGGCTGCCATTATATTCGTCACATCAGAACAGAGAGGATTGCTGGCAGCGGCA
GATACGGTGTTGCTGAAAAATGCTACTACTGATAAAGAGCGGGCTGCAGTCAATCGCAGGGTGTCAGAGGCCCAT
GTTGCGACTCAACGAACAATGTGTGCTAGAATCCAGGACCTAAGGCAGCAATTCGAGAAGGTCTTGCCGAGAAAA
GAGTGGCTATACCTCCGGGCAGCCGAATTTACTCAAAAATATATAGAGGAACTCGAAGAAGAAATTAAGCGTCGT
CATGTCGTTTCAGAGGGCTTCGTTACTTCATATCAGCGTACCTGGTACCCGGGGCTGTCTGATATGAGGGAATTT
GAACTCCTCAAAACCAAACTACGATGGTCAGCCATCATGAACGCCAAGGGCATAGAGTTTGCCAGCAAGGTCAAA
TCTATTTTCGACGGGATATTTGCAATACCCAGCGAGTGTATATGTGCTGATAAAGAGAATTATGCTAATCGCCCA
CGCCAAGAGTTGGAAGACGCACTGTTGTGCGCGACAGCCAACGGATATTCAGACATTGTCGAATGGCTCAATAAC
TGGCTTTTGCAACCCAAAATGCACGACGCTGATGGATTCACAGCGCTCATGCTTGCAGTAAAGCGAGGCAATGTG
GCCATTGTTGAGCTACTCGCGCAGAGAGCGGGCTCAGGCCTGCCTGCAAGCAAGGCCGAGGCAGCGCAATCCCTG
GCATCGAAATTAAAACAAGATGACATTGTCGCCCTGCTTCAGACCGAGGTCAAGGCCGATGCCCTCCTGTCTCTT
GCGTCCAAGGAGGGACGCGTTGGCGTTGTCGAGCTGTTCCGAAAGAGGGCTGTCGCTTACGTGGACCTTGCCAAC
AGCTTCAACAACACAGCGCTCATGTTGGCAGCAATGCATGGCCATCAGGATATGGTTCGACTACTCCTAGAAACG
GAGGCAGTTAACCCGAGGGCTCAGAACAATGACGGGGAAACAGCGCTGACGCTGGCAGCTGCGAGAGGCCACGAG
CAAATCGTCTCGGCGCTTCTAGCGGCAGTCGACAGAAAACAGAAGCTGGAAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail