Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1746
Gene name
LocationContig_15:92120..94073
Strand-
Gene length (bp)1953
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain 1.4E-102 116 421
PF03950 tRNA-synt_1c_C tRNA synthetases class I (E and Q), anti-codon binding domain 3.5E-38 425 602

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13775|SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gus1 PE=1 SV=1 16 629 0.0E+00
sp|P46655|SYEC_YEAST Glutamate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUS1 PE=1 SV=3 16 630 0.0E+00
sp|O82462|SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g26707 PE=1 SV=1 27 630 8.0E-176
sp|Q54KB8|SYEC_DICDI Probable glutamate--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=gluS PE=2 SV=1 24 631 3.0E-161
sp|Q8CGC7|SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus GN=Eprs PE=1 SV=4 24 603 6.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13775|SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gus1 PE=1 SV=1 16 629 0.0E+00
sp|P46655|SYEC_YEAST Glutamate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUS1 PE=1 SV=3 16 630 0.0E+00
sp|O82462|SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g26707 PE=1 SV=1 27 630 8.0E-176
sp|Q54KB8|SYEC_DICDI Probable glutamate--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=gluS PE=2 SV=1 24 631 3.0E-161
sp|Q8CGC7|SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus GN=Eprs PE=1 SV=4 24 603 6.0E-157
sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens GN=EPRS PE=1 SV=5 24 631 1.0E-156
sp|P28668|SYEP_DROME Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster GN=Aats-glupro PE=1 SV=2 24 631 7.0E-144
sp|Q8SSE4|SYEC_ENCCU Probable glutamate--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_1210 PE=3 SV=1 95 602 6.0E-141
sp|A9CSZ1|SYEC_ENTBH Probable glutamate--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22577 PE=3 SV=1 104 605 3.0E-124
sp|C4VBI7|SYEC_NOSCE Probable glutamate--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_102160 PE=3 SV=1 117 602 1.0E-120
sp|A6VP11|SYQ_ACTSZ Glutamine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=glnS PE=3 SV=1 95 602 2.0E-93
sp|P57847|SYQ_PASMU Glutamine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=glnS PE=3 SV=1 115 602 6.0E-93
sp|Q0SVB1|SYQ_CLOPS Glutamine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=glnS PE=3 SV=1 106 602 1.0E-92
sp|Q8XMP3|SYQ_CLOPE Glutamine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=glnS PE=3 SV=1 106 605 1.0E-92
sp|Q0TTG1|SYQ_CLOP1 Glutamine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glnS PE=3 SV=1 106 605 3.0E-92
sp|Q66DC5|SYQ_YERPS Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glnS PE=3 SV=1 115 602 2.0E-91
sp|A4TNX8|SYQ_YERPP Glutamine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=glnS PE=3 SV=1 115 602 2.0E-91
sp|Q1CKN4|SYQ_YERPN Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glnS PE=3 SV=1 115 602 2.0E-91
sp|A9R7G5|SYQ_YERPG Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=glnS PE=3 SV=1 115 602 2.0E-91
sp|Q8ZDD9|SYQ_YERPE Glutamine--tRNA ligase OS=Yersinia pestis GN=glnS PE=3 SV=1 115 602 2.0E-91
sp|B2K8A4|SYQ_YERPB Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=glnS PE=3 SV=1 115 602 2.0E-91
sp|Q1C540|SYQ_YERPA Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glnS PE=3 SV=1 115 602 2.0E-91
sp|A7FKU1|SYQ_YERP3 Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glnS PE=3 SV=1 115 602 2.0E-91
sp|B1JG85|SYQ_YERPY Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=glnS PE=3 SV=1 115 602 3.0E-91
sp|Q4QK64|SYQ_HAEI8 Glutamine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=glnS PE=3 SV=1 114 602 4.0E-91
sp|P43831|SYQ_HAEIN Glutamine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glnS PE=3 SV=1 114 602 7.0E-91
sp|Q324M4|SYQ_SHIBS Glutamine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=glnS PE=3 SV=1 116 602 2.0E-90
sp|B5XZG7|SYQ_KLEP3 Glutamine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=glnS PE=3 SV=1 116 602 4.0E-90
sp|B4EV71|SYQ_PROMH Glutamine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=glnS PE=3 SV=1 115 603 4.0E-90
sp|A1JQH0|SYQ_YERE8 Glutamine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glnS PE=3 SV=1 115 602 5.0E-90
sp|A6T6C3|SYQ_KLEP7 Glutamine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glnS PE=3 SV=1 116 602 5.0E-90
sp|A4W846|SYQ_ENT38 Glutamine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=glnS PE=3 SV=1 116 602 6.0E-90
sp|Q83LY4|SYQ_SHIFL Glutamine--tRNA ligase OS=Shigella flexneri GN=glnS PE=3 SV=1 116 602 7.0E-90
sp|Q0T6S8|SYQ_SHIF8 Glutamine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=glnS PE=3 SV=1 116 602 7.0E-90
sp|Q1REN7|SYQ_ECOUT Glutamine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=glnS PE=3 SV=1 116 602 8.0E-90
sp|Q8FJW4|SYQ_ECOL6 Glutamine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glnS PE=3 SV=3 116 602 8.0E-90
sp|Q0TK03|SYQ_ECOL5 Glutamine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glnS PE=3 SV=1 116 602 8.0E-90
sp|A1A8U7|SYQ_ECOK1 Glutamine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=glnS PE=3 SV=1 116 602 8.0E-90
sp|B7MPI5|SYQ_ECO81 Glutamine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=glnS PE=3 SV=1 116 602 8.0E-90
sp|B7MFU7|SYQ_ECO45 Glutamine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glnS PE=3 SV=1 116 602 8.0E-90
sp|B7UKW1|SYQ_ECO27 Glutamine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glnS PE=3 SV=1 116 602 8.0E-90
sp|Q7N743|SYQ_PHOLL Glutamine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glnS PE=3 SV=1 115 602 1.0E-89
sp|Q7VLM3|SYQ_HAEDU Glutamine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=glnS PE=3 SV=1 116 606 1.0E-89
sp|Q32IQ0|SYQ_SHIDS Glutamine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glnS PE=3 SV=1 116 602 1.0E-89
sp|B2TU51|SYQ_SHIB3 Glutamine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glnS PE=3 SV=1 116 602 1.0E-89
sp|B5YQM4|SYQ_ECO5E Glutamine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|Q8X9H8|SYQ_ECO57 Glutamine--tRNA ligase OS=Escherichia coli O157:H7 GN=glnS PE=3 SV=3 116 602 2.0E-89
sp|Q6D7J7|SYQ_PECAS Glutamine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glnS PE=3 SV=1 116 603 2.0E-89
sp|Q3Z4C0|SYQ_SHISS Glutamine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|B6HYN9|SYQ_ECOSE Glutamine--tRNA ligase OS=Escherichia coli (strain SE11) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|P00962|SYQ_ECOLI Glutamine--tRNA ligase OS=Escherichia coli (strain K12) GN=glnS PE=1 SV=3 116 602 2.0E-89
sp|B1IY48|SYQ_ECOLC Glutamine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|A7ZXU0|SYQ_ECOHS Glutamine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|B1X6L3|SYQ_ECODH Glutamine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|C4ZWF6|SYQ_ECOBW Glutamine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|B7M5J8|SYQ_ECO8A Glutamine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|B7L9L7|SYQ_ECO55 Glutamine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|A7ZJ63|SYQ_ECO24 Glutamine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glnS PE=3 SV=1 116 602 2.0E-89
sp|B7LKT3|SYQ_ESCF3 Glutamine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glnS PE=3 SV=1 116 602 3.0E-89
sp|B1LLC4|SYQ_ECOSM Glutamine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glnS PE=3 SV=1 116 602 3.0E-89
sp|B7N9S6|SYQ_ECOLU Glutamine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glnS PE=3 SV=1 116 602 3.0E-89
sp|C6DBY6|SYQ_PECCP Glutamine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glnS PE=3 SV=1 116 603 3.0E-89
sp|B7NMN1|SYQ_ECO7I Glutamine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glnS PE=3 SV=1 116 602 4.0E-89
sp|A7MQT2|SYQ_CROS8 Glutamine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=glnS PE=3 SV=1 116 602 7.0E-89
sp|Q7MMQ4|SYQ_VIBVY Glutamine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=glnS PE=3 SV=1 115 602 2.0E-88
sp|Q2NUP0|SYQ_SODGM Glutamine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=glnS PE=3 SV=1 115 602 4.0E-88
sp|A7MT45|SYQ_VIBCB Glutamine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=glnS PE=3 SV=1 115 602 4.0E-88
sp|A8GB43|SYQ_SERP5 Glutamine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=glnS PE=3 SV=1 114 602 4.0E-88
sp|B6EHL7|SYQ_ALISL Glutamine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=glnS PE=3 SV=1 115 602 6.0E-88
sp|Q57RP8|SYQ_SALCH Glutamine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=glnS PE=3 SV=1 116 602 8.0E-88
sp|Q8ZQX5|SYQ_SALTY Glutamine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glnS PE=3 SV=3 116 602 9.0E-88
sp|B5BCC3|SYQ_SALPK Glutamine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=glnS PE=3 SV=1 116 602 9.0E-88
sp|C0PWA7|SYQ_SALPC Glutamine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=glnS PE=3 SV=1 116 602 9.0E-88
sp|Q5PCH8|SYQ_SALPA Glutamine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glnS PE=3 SV=1 116 602 9.0E-88
sp|B4TB84|SYQ_SALHS Glutamine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=glnS PE=3 SV=1 116 602 9.0E-88
sp|B5R651|SYQ_SALG2 Glutamine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glnS PE=3 SV=1 116 602 9.0E-88
sp|B5QWD0|SYQ_SALEP Glutamine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=glnS PE=3 SV=1 116 602 9.0E-88
sp|B5FNC1|SYQ_SALDC Glutamine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=glnS PE=3 SV=1 116 602 9.0E-88
sp|B5EZC3|SYQ_SALA4 Glutamine--tRNA ligase OS=Salmonella agona (strain SL483) GN=glnS PE=3 SV=1 116 602 9.0E-88
sp|Q89KR6|SYQ_BRADU Glutamine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnS PE=3 SV=1 114 603 1.0E-87
sp|Q7W4T0|SYQ_BORPA Glutamine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glnS PE=3 SV=1 83 602 1.0E-87
sp|B4TQ00|SYQ_SALSV Glutamine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=glnS PE=3 SV=1 116 602 1.0E-87
sp|Q6LTD1|SYQ_PHOPR Glutamine--tRNA ligase OS=Photobacterium profundum GN=glnS PE=3 SV=1 114 602 1.0E-87
sp|Q87RG4|SYQ_VIBPA Glutamine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glnS PE=3 SV=1 115 602 1.0E-87
sp|B5FC12|SYQ_VIBFM Glutamine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=glnS PE=3 SV=1 115 602 1.0E-87
sp|Q5E6P2|SYQ_VIBF1 Glutamine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glnS PE=3 SV=1 115 602 1.0E-87
sp|Q7VU94|SYQ_BORPE Glutamine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glnS PE=3 SV=1 83 602 1.0E-87
sp|B4SYN9|SYQ_SALNS Glutamine--tRNA ligase OS=Salmonella newport (strain SL254) GN=glnS PE=3 SV=1 116 602 2.0E-87
sp|A5N6Y3|SYQ_CLOK5 Glutamine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glnS PE=3 SV=1 106 602 3.0E-87
sp|Q1LQ72|SYQ_CUPMC Glutamine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=glnS PE=3 SV=1 116 603 4.0E-87
sp|A8AJD6|SYQ_CITK8 Glutamine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glnS PE=3 SV=1 116 602 4.0E-87
sp|Q8Z8F8|SYQ_SALTI Glutamine--tRNA ligase OS=Salmonella typhi GN=glnS PE=3 SV=3 116 602 5.0E-87
sp|Q188C8|SYQ_PEPD6 Glutamine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=glnS PE=3 SV=1 97 602 6.0E-87
sp|Q7WGA6|SYQ_BORBR Glutamine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glnS PE=3 SV=1 83 602 9.0E-87
sp|A9MUG5|SYQ_SALPB Glutamine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glnS PE=3 SV=1 116 602 3.0E-86
sp|B0U6D0|SYQ_XYLFM Glutamine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=glnS PE=3 SV=1 112 603 3.0E-86
sp|Q1QMM1|SYQ_NITHX Glutamine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glnS PE=3 SV=1 114 603 4.0E-86
sp|B7VIH6|SYQ_VIBTL Glutamine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=glnS PE=3 SV=1 112 602 1.0E-85
sp|Q87DU6|SYQ_XYLFT Glutamine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=glnS PE=3 SV=1 112 603 1.0E-85
sp|Q7NX86|SYQ_CHRVO Glutamine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=glnS PE=3 SV=1 115 603 1.0E-85
sp|C3LTP5|SYQ_VIBCM Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=glnS PE=3 SV=1 116 628 2.0E-85
sp|Q9KTA6|SYQ_VIBCH Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glnS PE=3 SV=1 116 628 2.0E-85
sp|A5F2T1|SYQ_VIBC3 Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=glnS PE=3 SV=1 116 628 2.0E-85
sp|B2U846|SYQ_RALPJ Glutamine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=glnS PE=3 SV=1 116 603 3.0E-85
sp|A9MKA7|SYQ_SALAR Glutamine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glnS PE=3 SV=1 116 602 5.0E-85
sp|Q0K808|SYQ_CUPNH Glutamine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=glnS PE=3 SV=1 116 603 9.0E-85
sp|Q8Y199|SYQ_RALSO Glutamine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=glnS PE=3 SV=1 116 603 2.0E-84
sp|B2VBN3|SYQ_ERWT9 Glutamine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=glnS PE=3 SV=1 116 602 3.0E-84
sp|Q9PDP1|SYQ_XYLFA Glutamine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=glnS PE=3 SV=1 112 603 3.0E-84
sp|A4SZM1|SYQ_POLSQ Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=glnS PE=3 SV=1 115 603 3.0E-84
sp|C4K4J9|SYQ_HAMD5 Glutamine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=glnS PE=3 SV=1 116 603 3.0E-84
sp|Q15TT6|SYQ_PSEA6 Glutamine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glnS PE=3 SV=1 114 603 3.0E-84
sp|B3R5N3|SYQ_CUPTR Glutamine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=glnS PE=3 SV=1 116 603 4.0E-84
sp|C5BGA4|SYQ_EDWI9 Glutamine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=glnS PE=3 SV=1 115 602 2.0E-83
sp|Q7UX42|SYQ_RHOBA Glutamine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glnS PE=3 SV=1 115 602 6.0E-83
sp|B1XW11|SYQ_POLNS Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=glnS PE=3 SV=1 115 604 1.0E-82
sp|P57490|SYQ_BUCAI Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glnS PE=3 SV=1 110 602 1.0E-82
sp|B8D7U5|SYQ_BUCAT Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=glnS PE=3 SV=1 110 602 3.0E-82
sp|Q2KVX0|SYQ_BORA1 Glutamine--tRNA ligase OS=Bordetella avium (strain 197N) GN=glnS PE=3 SV=1 99 602 4.0E-82
sp|P57000|SYQ_NEIMA Glutamine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=glnS PE=3 SV=1 114 603 4.0E-82
sp|B8D9J3|SYQ_BUCA5 Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=glnS PE=3 SV=1 110 602 6.0E-82
sp|Q3SRI8|SYQ_NITWN Glutamine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=glnS PE=3 SV=1 114 603 8.0E-82
sp|Q8K9E1|SYQ_BUCAP Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=glnS PE=3 SV=2 118 603 1.0E-81
sp|Q5F7G0|SYQ_NEIG1 Glutamine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=glnS PE=3 SV=2 114 603 2.0E-81
sp|C4L887|SYQ_TOLAT Glutamine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=glnS PE=3 SV=1 115 606 3.0E-81
sp|A4XVG2|SYQ_PSEMY Glutamine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=glnS PE=3 SV=1 102 602 2.0E-80
sp|P56927|SYQ_NEIMB Glutamine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=glnS PE=3 SV=1 115 603 4.0E-80
sp|B4RYH7|SYQ_ALTMD Glutamine--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=glnS PE=3 SV=1 115 609 5.0E-79
sp|Q8PCB3|SYQ_XANCP Glutamine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glnS PE=3 SV=1 115 603 7.0E-79
sp|Q4UR70|SYQ_XANC8 Glutamine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glnS PE=3 SV=1 115 603 7.0E-79
sp|Q3BX52|SYQ_XANC5 Glutamine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glnS PE=3 SV=1 116 603 9.0E-79
sp|Q87YQ1|SYQ_PSESM Glutamine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glnS PE=3 SV=1 95 612 1.0E-78
sp|A1SS83|SYQ_PSYIN Glutamine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=glnS PE=3 SV=1 109 602 2.0E-78
sp|Q89AD4|SYQ_BUCBP Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=glnS PE=3 SV=1 116 606 2.0E-78
sp|Q9I2U8|SYQ_PSEAE Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glnS PE=1 SV=1 116 602 3.0E-78
sp|Q81ZS7|SYQ_NITEU Glutamine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=glnS1 PE=3 SV=1 116 602 4.0E-78
sp|Q8EG26|SYQ_SHEON Glutamine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=glnS PE=3 SV=1 115 602 8.0E-78
sp|Q8PNZ5|SYQ_XANAC Glutamine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glnS PE=3 SV=1 116 603 9.0E-78
sp|Q02KT5|SYQ_PSEAB Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=glnS PE=3 SV=1 116 602 1.0E-77
sp|B7VB85|SYQ_PSEA8 Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=glnS PE=3 SV=1 116 602 1.0E-77
sp|C1DHE5|SYQ_AZOVD Glutamine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=glnS PE=3 SV=1 116 602 2.0E-77
sp|Q5GWF4|SYQ_XANOR Glutamine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glnS PE=3 SV=1 116 602 5.0E-77
sp|Q2NZL7|SYQ_XANOM Glutamine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glnS PE=3 SV=1 116 602 5.0E-77
sp|Q5QXQ2|SYQ_IDILO Glutamine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glnS PE=3 SV=1 116 603 6.0E-77
sp|A4VL72|SYQ_PSEU5 Glutamine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=glnS PE=3 SV=1 111 611 7.0E-77
sp|P56926|SYQ_DEIRA Glutamine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glnS PE=1 SV=1 116 599 2.0E-76
sp|Q88IU5|SYQ_PSEPK Glutamine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=glnS PE=3 SV=1 81 602 3.0E-76
sp|Q3IGW8|SYQ_PSEHT Glutamine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=glnS PE=3 SV=1 118 602 6.0E-75
sp|P14325|SYQ_DICDI Probable glutamine--tRNA ligase OS=Dictyostelium discoideum GN=glnS PE=2 SV=2 109 603 2.0E-72
sp|P52780|SYQ_LUPLU Glutamine--tRNA ligase OS=Lupinus luteus PE=2 SV=2 109 603 2.0E-70
sp|Q9Y7Y8|SYQ_SCHPO Probable glutamine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qrs1 PE=3 SV=1 109 480 2.0E-69
sp|P13188|SYQ_YEAST Glutamine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN4 PE=1 SV=2 109 480 2.0E-68
sp|Q47Z40|SYQ_COLP3 Glutamine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glnS PE=3 SV=1 115 628 2.0E-68
sp|Q9Y105|SYQ_DROME Probable glutamine--tRNA ligase OS=Drosophila melanogaster GN=Aats-gln PE=2 SV=1 109 602 5.0E-68
sp|B1L5U2|SYE_KORCO Glutamate--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=gltX PE=3 SV=1 109 603 6.0E-67
sp|O59314|SYE_PYRHO Glutamate--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gltX PE=3 SV=1 109 607 2.0E-66
sp|Q8W4F3|SYQ_ARATH Glutamine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=OVA9 PE=2 SV=1 109 603 5.0E-66
sp|Q9V1E3|SYE_PYRAB Glutamate--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gltX PE=3 SV=1 109 607 1.0E-64
sp|A9A423|SYE_NITMS Glutamate--tRNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=gltX PE=3 SV=1 109 602 9.0E-63
sp|Q58772|SYE_METJA Glutamate--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gltX PE=3 SV=1 107 603 3.0E-62
sp|Q5JH16|SYE_THEKO Glutamate--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gltX PE=3 SV=1 109 602 8.0E-62
sp|P47897|SYQ_HUMAN Glutamine--tRNA ligase OS=Homo sapiens GN=QARS PE=1 SV=1 109 602 9.0E-62
sp|B6YSY7|SYE_THEON Glutamate--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=gltX PE=3 SV=1 109 602 1.0E-61
sp|Q3MHH4|SYQ_BOVIN Glutamine--tRNA ligase OS=Bos taurus GN=QARS PE=2 SV=1 109 602 8.0E-60
sp|Q8U064|SYE_PYRFU Glutamate--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gltX PE=3 SV=2 109 603 2.0E-59
sp|O62431|SYQ_CAEEL Probable glutamine--tRNA ligase OS=Caenorhabditis elegans GN=ers-1 PE=3 SV=1 116 603 5.0E-59
sp|A9CSU5|SYQ_ENTBH Probable glutamine--tRNA ligase OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22570 PE=3 SV=1 109 602 1.0E-58
sp|A0RY20|SYE_CENSY Glutamate--tRNA ligase OS=Cenarchaeum symbiosum (strain A) GN=gltX PE=3 SV=1 81 506 7.0E-58
sp|Q8SR10|SYQ_ENCCU Probable glutamine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_1460 PE=3 SV=1 109 603 1.0E-56
sp|C4V819|SYQ_NOSCE Probable glutamine--tRNA ligase OS=Nosema ceranae (strain BRL01) GN=NCER_100619 PE=3 SV=1 109 602 2.0E-56
sp|A9AAT7|SYE_METM6 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gltX PE=3 SV=1 94 603 8.0E-54
sp|A5UN79|SYE_METS3 Glutamate--tRNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=gltX PE=3 SV=1 109 603 1.0E-53
sp|A6UW15|SYE_META3 Glutamate--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=gltX PE=3 SV=1 97 603 2.0E-53
sp|A6VFU7|SYE_METM7 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gltX PE=3 SV=1 94 603 7.0E-53
sp|Q6LYI0|SYE_METMP Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=gltX PE=3 SV=1 94 605 1.0E-52
sp|Q979Q0|SYE_THEVO Glutamate--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gltX PE=3 SV=1 109 492 3.0E-52
sp|O26157|SYE_METTH Glutamate--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=gltX PE=1 SV=1 116 623 4.0E-52
sp|Q50543|SYE_METTM Glutamate--tRNA ligase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=gltX PE=3 SV=1 109 623 5.0E-52
sp|A4FXG8|SYE_METM5 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gltX PE=3 SV=1 94 603 2.0E-50
sp|A3CWJ3|SYE_METMJ Glutamate--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=gltX PE=3 SV=1 109 606 2.0E-49
sp|A0B966|SYE_METTP Glutamate--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=gltX PE=3 SV=1 73 602 3.0E-49
sp|Q2NFU2|SYE_METST Glutamate--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=gltX PE=3 SV=1 79 603 7.0E-49
sp|Q8TT52|SYE_METAC Glutamate--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gltX PE=3 SV=2 53 602 9.0E-49
sp|Q971D0|SYE_SULTO Glutamate--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gltX PE=3 SV=1 117 605 2.0E-47
sp|Q46CG5|SYE_METBF Glutamate--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gltX PE=3 SV=1 53 602 2.0E-47
sp|Q74MU5|SYE_NANEQ Glutamate--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=gltX PE=3 SV=1 65 485 4.0E-47
sp|A6UP25|SYE_METVS Glutamate--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gltX PE=3 SV=1 94 607 6.0E-47
sp|A2BK91|SYE_HYPBU Glutamate--tRNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=gltX PE=3 SV=1 109 602 7.0E-47
sp|A7IAG1|SYE_METB6 Glutamate--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=gltX PE=3 SV=1 109 480 2.0E-46
sp|Q8TXB7|SYE_METKA Glutamate--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=gltX PE=3 SV=1 116 503 5.0E-46
sp|A2SRG2|SYE_METLZ Glutamate--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=gltX PE=3 SV=1 109 480 6.0E-46
sp|Q9HJM5|SYE_THEAC Glutamate--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gltX PE=3 SV=2 109 492 1.0E-45
sp|Q2FTH6|SYE_METHJ Glutamate--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gltX PE=3 SV=1 109 486 1.0E-44
sp|Q4J8P2|SYE_SULAC Glutamate--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gltX PE=3 SV=1 116 482 8.0E-44
sp|P95968|SYE_SULSO Glutamate--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gltX PE=3 SV=1 109 603 1.0E-42
sp|Q8PW52|SYE_METMA Glutamate--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gltX PE=3 SV=1 116 602 1.0E-41
sp|A4YIL8|SYE_METS5 Glutamate--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=gltX PE=3 SV=1 109 602 1.0E-41
sp|O29979|SYE_ARCFU Glutamate--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gltX PE=3 SV=1 65 500 4.0E-41
sp|Q18GA5|SYE_HALWD Glutamate--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gltX PE=3 SV=1 114 602 5.0E-41
sp|Q0W8L2|SYE_METAR Glutamate--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=gltX PE=3 SV=1 99 602 1.0E-40
sp|A1RYD7|SYE_THEPD Glutamate--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=gltX PE=3 SV=1 110 502 3.0E-40
sp|Q9HQI1|SYE_HALSA Glutamate--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gltX PE=3 SV=1 116 602 1.0E-39
sp|B0R4Z6|SYE_HALS3 Glutamate--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gltX PE=3 SV=1 116 602 1.0E-39
sp|Q9Y9H1|SYE_AERPE Glutamate--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gltX PE=3 SV=2 77 518 2.0E-39
sp|A3MV95|SYE_PYRCJ Glutamate--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=gltX PE=3 SV=1 77 498 6.0E-39
sp|A3DMR5|SYE_STAMF Glutamate--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=gltX PE=3 SV=1 109 602 2.0E-38
sp|Q8ZU33|SYE_PYRAE Glutamate--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=gltX PE=3 SV=1 64 498 5.0E-38
sp|A4WKI4|SYE_PYRAR Glutamate--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=gltX PE=3 SV=1 109 503 1.0E-37
sp|Q5V5N9|SYE_HALMA Glutamate--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gltX PE=3 SV=1 116 603 2.0E-37
sp|A8ABI5|SYE_IGNH4 Glutamate--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=gltX PE=3 SV=1 109 497 9.0E-37
sp|A8M9D7|SYE_CALMQ Glutamate--tRNA ligase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=gltX PE=3 SV=1 109 601 4.0E-36
sp|A1RRG7|SYE_PYRIL Glutamate--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=gltX PE=3 SV=1 106 498 1.0E-35
sp|B1YAX4|SYE_PYRNV Glutamate--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=gltX PE=3 SV=1 109 503 8.0E-35
sp|Q12TN7|SYE_METBU Glutamate--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gltX PE=3 SV=1 114 602 2.0E-34
sp|Q6L0N9|SYE_PICTO Glutamate--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=gltX PE=3 SV=1 109 421 5.0E-34
sp|Q3IPL2|SYE_NATPD Glutamate--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gltX PE=3 SV=1 116 603 4.0E-32
sp|B4U896|SYE_HYDS0 Glutamate--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=gltX PE=3 SV=1 116 356 1.0E-18
sp|O67271|SYE_AQUAE Glutamate--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=gltX PE=3 SV=1 116 399 5.0E-18
sp|Q30Y02|SYE_DESAG Glutamate--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=gltX PE=3 SV=1 116 362 2.0E-17
sp|A6Q6F9|SYE1_SULNB Glutamate--tRNA ligase 1 OS=Sulfurovum sp. (strain NBC37-1) GN=gltX1 PE=3 SV=1 117 347 3.0E-15
sp|Q47SA6|SYE_THEFY Glutamate--tRNA ligase OS=Thermobifida fusca (strain YX) GN=gltX PE=3 SV=1 112 334 4.0E-15
sp|B5Y7R0|SYE_COPPD Glutamate--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gltX PE=3 SV=1 116 438 7.0E-15
sp|Q5F5J8|SYE_NEIG1 Glutamate--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gltX PE=3 SV=1 116 334 9.0E-15
sp|B4RPQ3|SYE_NEIG2 Glutamate--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gltX PE=3 SV=1 116 334 1.0E-14
sp|Q728Q1|SYE_DESVH Glutamate--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gltX PE=3 SV=1 116 369 1.0E-14
sp|A1KWM9|SYE_NEIMF Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gltX PE=3 SV=1 116 334 1.0E-14
sp|Q9JWT4|SYE_NEIMA Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gltX PE=3 SV=1 116 334 1.0E-14
sp|A1VBA3|SYE_DESVV Glutamate--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gltX PE=3 SV=1 116 369 1.0E-14
sp|B5EEE6|SYE_GEOBB Glutamate--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gltX PE=3 SV=1 116 399 2.0E-14
sp|Q8G0E8|SYE2_BRUSU Glutamate--tRNA ligase 2 OS=Brucella suis biovar 1 (strain 1330) GN=gltX2 PE=3 SV=1 114 399 2.0E-14
sp|Q30UA5|SYE1_SULDN Glutamate--tRNA ligase 1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gltX1 PE=3 SV=1 116 399 3.0E-14
sp|B0CGU5|SYE2_BRUSI Glutamate--tRNA ligase 2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gltX2 PE=3 SV=1 114 399 5.0E-14
sp|A5VQR9|SYE2_BRUO2 Glutamate--tRNA ligase 2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gltX2 PE=3 SV=1 114 399 5.0E-14
sp|A9M5G0|SYE2_BRUC2 Glutamate--tRNA ligase 2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gltX2 PE=3 SV=1 114 399 5.0E-14
sp|Q57CZ2|SYE2_BRUAB Glutamate--tRNA ligase 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=gltX2 PE=3 SV=1 114 399 6.0E-14
sp|Q2YRQ9|SYE2_BRUA2 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain 2308) GN=gltX2 PE=3 SV=1 114 399 6.0E-14
sp|B2S5Z7|SYE2_BRUA1 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain S19) GN=gltX2 PE=3 SV=1 114 399 6.0E-14
sp|Q8YHG4|SYE1_BRUME Glutamate--tRNA ligase 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gltX1 PE=3 SV=2 114 399 6.0E-14
sp|A7H0G1|SYE2_CAMC5 Glutamate--tRNA ligase 2 OS=Campylobacter curvus (strain 525.92) GN=gltX2 PE=3 SV=1 116 399 8.0E-14
sp|A9LZH6|SYE_NEIM0 Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gltX PE=3 SV=1 116 334 1.0E-13
sp|B5YEP5|SYE_DICT6 Glutamate--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=gltX PE=3 SV=1 115 370 2.0E-13
sp|A6X0K5|SYE1_OCHA4 Glutamate--tRNA ligase 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gltX1 PE=3 SV=1 114 399 2.0E-13
sp|B5YIG1|SYE_THEYD Glutamate--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gltX PE=3 SV=1 116 356 2.0E-13
sp|Q6FZN9|SYE2_BARQU Glutamate--tRNA ligase 2 OS=Bartonella quintana (strain Toulouse) GN=gltX2 PE=3 SV=1 116 413 2.0E-13
sp|A7HZN3|SYE1_CAMHC Glutamate--tRNA ligase 1 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=gltX1 PE=3 SV=1 116 399 2.0E-13
sp|Q3A413|SYE_PELCD Glutamate--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gltX PE=3 SV=1 118 370 2.0E-13
sp|Q9ZLZ7|SYE1_HELPJ Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gltX1 PE=3 SV=1 116 325 2.0E-13
sp|P96551|SYE1_HELPY Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gltX1 PE=3 SV=2 116 325 3.0E-13
sp|A7ZFB9|SYE2_CAMC1 Glutamate--tRNA ligase 2 OS=Campylobacter concisus (strain 13826) GN=gltX2 PE=3 SV=1 116 416 3.0E-13
sp|A8I819|SYE_AZOC5 Glutamate--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gltX PE=3 SV=2 116 399 3.0E-13
sp|Q0BS88|SYE2_GRABC Glutamate--tRNA ligase 2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gltX2 PE=3 SV=1 116 403 4.0E-13
sp|Q9K1R6|SYE_NEIMB Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gltX PE=3 SV=1 116 325 4.0E-13
sp|Q8RB93|SYE1_CALS4 Glutamate--tRNA ligase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gltX1 PE=3 SV=1 116 370 4.0E-13
sp|B6EJQ3|SYE_ALISL Glutamate--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=gltX PE=3 SV=1 116 334 6.0E-13
sp|P0C6Q1|SYE_VIBCH Glutamate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gltX PE=3 SV=1 116 325 6.0E-13
sp|A5F649|SYE_VIBC3 Glutamate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gltX PE=3 SV=2 116 325 6.0E-13
sp|B0K403|SYE2_THEPX Glutamate--tRNA ligase 2 OS=Thermoanaerobacter sp. (strain X514) GN=gltX2 PE=3 SV=1 116 370 7.0E-13
sp|B0KAA6|SYE2_THEP3 Glutamate--tRNA ligase 2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gltX2 PE=3 SV=1 116 370 7.0E-13
sp|Q0AUF7|SYE2_SYNWW Glutamate--tRNA ligase 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gltX2 PE=3 SV=1 116 356 7.0E-13
sp|Q98MD0|SYE1_RHILO Glutamate--tRNA ligase 1 OS=Rhizobium loti (strain MAFF303099) GN=gltX1 PE=3 SV=1 116 370 9.0E-13
sp|Q7VHN8|SYE1_HELHP Glutamate--tRNA ligase 1 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gltX1 PE=3 SV=1 116 335 9.0E-13
sp|B6JL62|SYE1_HELP2 Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain P12) GN=gltX1 PE=3 SV=1 116 325 1.0E-12
sp|Q2W7Y6|SYE1_MAGSA Glutamate--tRNA ligase 1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gltX1 PE=3 SV=1 117 329 1.0E-12
sp|B5FGU2|SYE_VIBFM Glutamate--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=gltX PE=3 SV=1 116 334 1.0E-12
sp|Q5E3L4|SYE_VIBF1 Glutamate--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gltX PE=3 SV=1 116 334 1.0E-12
sp|Q28L59|SYE2_JANSC Glutamate--tRNA ligase 2 OS=Jannaschia sp. (strain CCS1) GN=gltX2 PE=3 SV=1 116 404 1.0E-12
sp|B5Z6J9|SYE1_HELPG Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain G27) GN=gltX1 PE=3 SV=1 116 325 1.0E-12
sp|Q1CU52|SYE1_HELPH Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain HPAG1) GN=gltX1 PE=3 SV=1 116 325 2.0E-12
sp|Q7MMW8|SYE_VIBVY Glutamate--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=gltX PE=3 SV=1 116 334 2.0E-12
sp|Q8DFH5|SYE_VIBVU Glutamate--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=gltX PE=3 SV=1 116 334 2.0E-12
sp|A1W0S2|SYE2_CAMJJ Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gltX2 PE=3 SV=1 116 399 2.0E-12
sp|A8FMZ3|SYE2_CAMJ8 Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gltX2 PE=3 SV=1 116 399 2.0E-12
sp|O52914|SYE2_CAMJE Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gltX2 PE=3 SV=2 116 399 2.0E-12
sp|B0UL61|SYE2_METS4 Glutamate--tRNA ligase 2 OS=Methylobacterium sp. (strain 4-46) GN=gltX2 PE=3 SV=1 117 209 2.0E-12
sp|A4XHE0|SYE1_CALS8 Glutamate--tRNA ligase 1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX1 PE=3 SV=1 116 370 2.0E-12
sp|Q5HTB9|SYE2_CAMJR Glutamate--tRNA ligase 2 OS=Campylobacter jejuni (strain RM1221) GN=gltX2 PE=3 SV=1 116 399 2.0E-12
sp|Q0A936|SYE1_ALKEH Glutamate--tRNA ligase 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gltX1 PE=3 SV=1 116 335 3.0E-12
sp|Q17WW9|SYE2_HELAH Glutamate--tRNA ligase 2 OS=Helicobacter acinonychis (strain Sheeba) GN=gltX2 PE=3 SV=1 116 325 3.0E-12
sp|B2UST7|SYE1_HELPS Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain Shi470) GN=gltX1 PE=3 SV=1 116 325 4.0E-12
sp|A5G3W1|SYE_GEOUR Glutamate--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=gltX PE=3 SV=1 116 399 4.0E-12
sp|A1USF5|SYE1_BARBK Glutamate--tRNA ligase 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gltX1 PE=3 SV=1 116 399 4.0E-12
sp|Q896M5|SYE_CLOTE Glutamate--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=gltX PE=3 SV=2 116 334 4.0E-12
sp|B0U106|SYE_FRAP2 Glutamate--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gltX PE=3 SV=1 116 325 4.0E-12
sp|A6LJ42|SYE1_THEM4 Glutamate--tRNA ligase 1 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gltX1 PE=3 SV=1 116 319 5.0E-12
sp|A7H295|SYE1_CAMJD Glutamate--tRNA ligase 1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gltX1 PE=3 SV=1 116 347 5.0E-12
sp|B3CST4|SYE2_ORITI Glutamate--tRNA ligase 2 OS=Orientia tsutsugamushi (strain Ikeda) GN=gltX2 PE=3 SV=2 116 230 5.0E-12
sp|B1I9D7|SYE_STRPI Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gltX PE=3 SV=1 114 399 6.0E-12
sp|Q1GEA9|SYE2_RUEST Glutamate--tRNA ligase 2 OS=Ruegeria sp. (strain TM1040) GN=gltX2 PE=3 SV=1 116 447 6.0E-12
sp|A5CD02|SYE1_ORITB Glutamate--tRNA ligase 1 OS=Orientia tsutsugamushi (strain Boryong) GN=gltX1 PE=3 SV=2 116 334 7.0E-12
sp|Q87RL6|SYE_VIBPA Glutamate--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gltX PE=3 SV=1 116 334 7.0E-12
sp|A7INJ6|SYE1_XANP2 Glutamate--tRNA ligase 1 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gltX1 PE=3 SV=1 116 399 7.0E-12
sp|A0PZ93|SYE_CLONN Glutamate--tRNA ligase OS=Clostridium novyi (strain NT) GN=gltX PE=3 SV=1 114 334 7.0E-12
sp|A1B0F1|SYE1_PARDP Glutamate--tRNA ligase 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=gltX1 PE=3 SV=1 116 404 8.0E-12
sp|Q39UV7|SYE_GEOMG Glutamate--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gltX PE=3 SV=1 116 362 8.0E-12
sp|A5IZ19|SYE_MYCAP Glutamate--tRNA ligase OS=Mycoplasma agalactiae (strain PG2) GN=gltX PE=3 SV=1 116 360 9.0E-12
sp|Q03E40|SYE_PEDPA Glutamate--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gltX PE=3 SV=1 116 399 9.0E-12
sp|A8F597|SYE1_PSELT Glutamate--tRNA ligase 1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gltX1 PE=3 SV=1 116 315 9.0E-12
sp|Q3SRI7|SYE_NITWN Glutamate--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gltX PE=3 SV=2 116 399 1.0E-11
sp|A7MY61|SYE_VIBCB Glutamate--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gltX PE=3 SV=1 116 334 1.0E-11
sp|A9ISQ6|SYE1_BART1 Glutamate--tRNA ligase 1 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gltX1 PE=3 SV=1 116 399 1.0E-11
sp|A8LIP0|SYE2_DINSH Glutamate--tRNA ligase 2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gltX2 PE=3 SV=1 116 406 1.0E-11
sp|B3PN19|SYE_MYCA5 Glutamate--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=gltX PE=3 SV=1 113 453 1.0E-11
sp|B1I4Z1|SYE_DESAP Glutamate--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=gltX PE=3 SV=1 116 370 1.0E-11
sp|B1LBX4|SYE2_THESQ Glutamate--tRNA ligase 2 OS=Thermotoga sp. (strain RQ2) GN=gltX2 PE=3 SV=1 116 315 2.0E-11
sp|A5IMM2|SYE2_THEP1 Glutamate--tRNA ligase 2 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gltX2 PE=3 SV=1 116 315 2.0E-11
sp|Q9X172|SYE1_THEMA Glutamate--tRNA ligase 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gltX1 PE=1 SV=1 116 315 2.0E-11
sp|Q1MR60|SYE_LAWIP Glutamate--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gltX PE=3 SV=1 114 360 2.0E-11
sp|A0Q4G6|SYE_FRATN Glutamate--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=gltX PE=3 SV=1 116 325 2.0E-11
sp|Q6MKR6|SYE_BDEBA Glutamate--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gltX PE=3 SV=1 116 382 2.0E-11
sp|Q16AX5|SYE1_ROSDO Glutamate--tRNA ligase 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gltX1 PE=3 SV=1 116 452 3.0E-11
sp|Q5NHY6|SYE_FRATT Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gltX PE=3 SV=1 116 325 3.0E-11
sp|Q14JD8|SYE_FRAT1 Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gltX PE=3 SV=1 116 325 3.0E-11
sp|Q0BNU3|SYE_FRATO Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gltX PE=3 SV=1 116 325 3.0E-11
sp|Q2A5I8|SYE_FRATH Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gltX PE=3 SV=1 116 325 3.0E-11
sp|A7N9Q8|SYE_FRATF Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gltX PE=3 SV=1 116 325 3.0E-11
sp|Q6G3V8|SYE1_BARHE Glutamate--tRNA ligase 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gltX1 PE=3 SV=1 116 399 3.0E-11
sp|B4S404|SYE_PROA2 Glutamate--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gltX PE=3 SV=1 116 437 3.0E-11
sp|A4IZU9|SYE_FRATW Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gltX PE=3 SV=1 116 325 3.0E-11
sp|B2SE01|SYE_FRATM Glutamate--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gltX PE=3 SV=1 116 325 3.0E-11
sp|Q73HV5|SYE1_WOLPM Glutamate--tRNA ligase 1 OS=Wolbachia pipientis wMel GN=gltX1 PE=3 SV=1 115 319 3.0E-11
sp|A4J0Y7|SYE_DESRM Glutamate--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=gltX PE=3 SV=1 116 363 3.0E-11
sp|Q2LQN4|SYE1_SYNAS Glutamate--tRNA ligase 1 OS=Syntrophus aciditrophicus (strain SB) GN=gltX1 PE=3 SV=1 114 370 3.0E-11
sp|A1S7Q6|SYE_SHEAM Glutamate--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gltX PE=3 SV=1 116 334 3.0E-11
sp|Q73R87|SYE_TREDE Glutamate--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gltX PE=3 SV=1 116 334 3.0E-11
sp|A7ZCB6|SYE1_CAMC1 Glutamate--tRNA ligase 1 OS=Campylobacter concisus (strain 13826) GN=gltX1 PE=3 SV=1 119 334 3.0E-11
sp|Q8EYM3|SYE_LEPIN Glutamate--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gltX PE=3 SV=1 111 372 4.0E-11
sp|Q72M46|SYE_LEPIC Glutamate--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gltX PE=3 SV=1 111 372 4.0E-11
sp|Q5LWB2|SYE1_RUEPO Glutamate--tRNA ligase 1 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gltX1 PE=3 SV=1 116 451 4.0E-11
sp|B5ZCB4|SYE_UREU1 Glutamate--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=gltX PE=3 SV=1 118 348 4.0E-11
sp|B2IGY0|SYE2_BEII9 Glutamate--tRNA ligase 2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gltX2 PE=3 SV=1 117 227 4.0E-11
sp|A5N867|SYE_CLOK5 Glutamate--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gltX PE=3 SV=1 116 334 5.0E-11
sp|Q15RR1|SYE_PSEA6 Glutamate--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gltX PE=3 SV=1 117 334 5.0E-11
sp|B2FHI7|SYE_STRMK Glutamate--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=gltX PE=3 SV=1 118 504 5.0E-11
sp|Q5PAG8|SYE2_ANAMM Glutamate--tRNA ligase 2 OS=Anaplasma marginale (strain St. Maries) GN=gltX2 PE=3 SV=2 116 399 5.0E-11
sp|B3E399|SYE_GEOLS Glutamate--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gltX PE=3 SV=1 118 334 5.0E-11
sp|Q3A9N9|SYE_CARHZ Glutamate--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gltX PE=3 SV=1 116 370 5.0E-11
sp|A4XLI3|SYE2_CALS8 Glutamate--tRNA ligase 2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX2 PE=3 SV=1 116 363 6.0E-11
sp|B5EMF9|SYE1_ACIF5 Glutamate--tRNA ligase 1 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=gltX1 PE=3 SV=1 116 336 6.0E-11
sp|B3CLF5|SYE2_WOLPP Glutamate--tRNA ligase 2 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gltX2 PE=3 SV=1 115 319 6.0E-11
sp|Q2JRD6|SYE_SYNJA Glutamate--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gltX PE=3 SV=1 116 334 6.0E-11
sp|Q74DU6|SYE_GEOSL Glutamate--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gltX PE=3 SV=1 116 362 6.0E-11
sp|Q1RJC6|SYE2_RICBR Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain RML369-C) GN=gltX2 PE=3 SV=1 116 319 7.0E-11
sp|A8GX08|SYE2_RICB8 Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain OSU 85-389) GN=gltX2 PE=3 SV=2 116 319 7.0E-11
sp|Q03U68|SYE1_LACBA Glutamate--tRNA ligase 1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=gltX1 PE=3 SV=1 114 399 7.0E-11
sp|Q5QX98|SYE_IDILO Glutamate--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gltX PE=3 SV=1 116 334 7.0E-11
sp|Q1D8Y1|SYE_MYXXD Glutamate--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=gltX PE=3 SV=1 118 493 8.0E-11
sp|B0TBU3|SYE_HELMI Glutamate--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gltX PE=3 SV=1 114 356 8.0E-11
sp|B1ZAR5|SYE2_METPB Glutamate--tRNA ligase 2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gltX2 PE=3 SV=1 117 404 9.0E-11
sp|Q1BHL9|SYE_BURCA Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=gltX PE=3 SV=1 114 334 9.0E-11
sp|B4ECR7|SYE_BURCJ Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gltX PE=3 SV=1 114 334 9.0E-11
sp|B3QQC6|SYE_CHLP8 Glutamate--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gltX PE=3 SV=2 116 357 9.0E-11
sp|A0K8I0|SYE_BURCH Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=gltX PE=3 SV=1 114 334 1.0E-10
sp|B1JUI6|SYE_BURCC Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=gltX PE=3 SV=1 114 334 1.0E-10
sp|Q7VNZ3|SYE_HAEDU Glutamate--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gltX PE=3 SV=1 111 334 1.0E-10
sp|Q5NY25|SYE_AROAE Glutamate--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=gltX PE=3 SV=1 116 334 1.0E-10
sp|Q02W76|SYE_LACLS Glutamate--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gltX PE=3 SV=1 113 399 1.0E-10
sp|B4SPM7|SYE_STRM5 Glutamate--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gltX PE=3 SV=1 118 518 1.0E-10
sp|Q3JEF2|SYE1_NITOC Glutamate--tRNA ligase 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gltX1 PE=3 SV=1 116 334 1.0E-10
sp|Q0AIP6|SYE_NITEC Glutamate--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=gltX PE=3 SV=1 116 334 1.0E-10
sp|P57906|SYE_PASMU Glutamate--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=gltX PE=3 SV=1 108 334 1.0E-10
sp|A9ISS8|SYE2_BART1 Glutamate--tRNA ligase 2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gltX2 PE=3 SV=1 116 223 1.0E-10
sp|Q1QMM2|SYE_NITHX Glutamate--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gltX PE=3 SV=2 116 399 2.0E-10
sp|A4W496|SYE_STRS2 Glutamate--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=gltX PE=3 SV=2 114 395 2.0E-10
sp|A9W982|SYE2_METEP Glutamate--tRNA ligase 2 OS=Methylobacterium extorquens (strain PA1) GN=gltX2 PE=3 SV=1 117 404 2.0E-10
sp|B0S0W2|SYE_FINM2 Glutamate--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=gltX PE=3 SV=1 116 360 2.0E-10
sp|A3PMJ1|SYE2_RHOS1 Glutamate--tRNA ligase 2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gltX2 PE=3 SV=1 116 404 2.0E-10
sp|A8G3I8|SYE_PROM2 Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=gltX PE=3 SV=1 119 336 2.0E-10
sp|Q7VDB2|SYE_PROMA Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gltX PE=3 SV=1 116 337 2.0E-10
sp|A8EY39|SYE1_RICCK Glutamate--tRNA ligase 1 OS=Rickettsia canadensis (strain McKiel) GN=gltX1 PE=3 SV=1 115 230 2.0E-10
sp|B2IKL1|SYE1_BEII9 Glutamate--tRNA ligase 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gltX1 PE=3 SV=1 116 403 2.0E-10
sp|Q97KC9|SYE_CLOAB Glutamate--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gltX PE=3 SV=1 118 334 2.0E-10
sp|A3PBJ6|SYE_PROM0 Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=gltX PE=3 SV=1 119 319 2.0E-10
sp|A0RR62|SYE2_CAMFF Glutamate--tRNA ligase 2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=gltX2 PE=3 SV=1 116 347 2.0E-10
sp|A4SGA5|SYE_CHLPM Glutamate--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gltX PE=3 SV=1 114 334 2.0E-10
sp|A4XA62|SYE_SALTO Glutamate--tRNA ligase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=gltX PE=3 SV=1 119 357 2.0E-10
sp|A3CQQ6|SYE_STRSV Glutamate--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=gltX PE=3 SV=1 114 399 2.0E-10
sp|Q04GX5|SYE_OENOB Glutamate--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=gltX PE=3 SV=1 116 395 2.0E-10
sp|Q5NL22|SYE2_ZYMMO Glutamate--tRNA ligase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gltX2 PE=3 SV=1 116 342 2.0E-10
sp|B0UQ09|SYE1_METS4 Glutamate--tRNA ligase 1 OS=Methylobacterium sp. (strain 4-46) GN=gltX1 PE=3 SV=1 116 399 3.0E-10
sp|A8FXE0|SYE_SHESH Glutamate--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=gltX PE=3 SV=1 118 334 3.0E-10
sp|Q39F07|SYE_BURL3 Glutamate--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gltX PE=3 SV=2 114 334 3.0E-10
sp|A6Q5I8|SYE2_NITSB Glutamate--tRNA ligase 2 OS=Nitratiruptor sp. (strain SB155-2) GN=gltX2 PE=3 SV=1 116 399 3.0E-10
sp|Q2NA91|SYE1_ERYLH Glutamate--tRNA ligase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=gltX1 PE=3 SV=2 116 321 3.0E-10
sp|B3Q6P5|SYE_RHOPT Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=gltX PE=3 SV=1 116 399 3.0E-10
sp|A1SVA7|SYE_PSYIN Glutamate--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=gltX PE=3 SV=1 116 334 3.0E-10
sp|Q9PPP0|SYE_UREPA Glutamate--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=gltX PE=3 SV=1 118 348 3.0E-10
sp|B1AJP0|SYE_UREP2 Glutamate--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=gltX PE=3 SV=1 118 348 3.0E-10
sp|A2RNK5|SYE_LACLM Glutamate--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gltX PE=3 SV=1 113 399 3.0E-10
sp|A8EQW9|SYE1_ARCB4 Glutamate--tRNA ligase 1 OS=Arcobacter butzleri (strain RM4018) GN=gltX1 PE=3 SV=1 117 399 3.0E-10
sp|A7HKV0|SYE1_FERNB Glutamate--tRNA ligase 1 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=gltX1 PE=3 SV=1 116 315 4.0E-10
sp|A4WPH4|SYE1_RHOS5 Glutamate--tRNA ligase 1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gltX1 PE=3 SV=1 116 404 4.0E-10
sp|Q11HT5|SYE2_CHESB Glutamate--tRNA ligase 2 OS=Chelativorans sp. (strain BNC1) GN=gltX2 PE=3 SV=1 116 370 4.0E-10
sp|A7GCD9|SYE_CLOBL Glutamate--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gltX PE=3 SV=1 116 334 4.0E-10
sp|A5I0T6|SYE_CLOBH Glutamate--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gltX PE=3 SV=1 116 334 4.0E-10
sp|A7FSY9|SYE_CLOB1 Glutamate--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gltX PE=3 SV=1 116 334 4.0E-10
sp|B1IIG7|SYE_CLOBK Glutamate--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=gltX PE=3 SV=1 116 334 4.0E-10
sp|A7GXI1|SYE1_CAMC5 Glutamate--tRNA ligase 1 OS=Campylobacter curvus (strain 525.92) GN=gltX1 PE=3 SV=1 119 334 4.0E-10
sp|A8AUN5|SYE_STRGC Glutamate--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gltX PE=3 SV=1 114 399 4.0E-10
sp|Q8RDZ8|SYE_FUSNN Glutamate--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gltX PE=3 SV=2 111 357 4.0E-10
sp|B6JLN1|SYE2_HELP2 Glutamate--tRNA ligase 2 OS=Helicobacter pylori (strain P12) GN=gltX2 PE=3 SV=1 117 380 4.0E-10
sp|B1KYV1|SYE_CLOBM Glutamate--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gltX PE=3 SV=1 116 334 5.0E-10
sp|A9KUU5|SYE_SHEB9 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS195) GN=gltX PE=3 SV=1 118 334 5.0E-10
sp|A6WQ67|SYE_SHEB8 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS185) GN=gltX PE=3 SV=1 118 334 5.0E-10
sp|B1MWU1|SYE_LEUCK Glutamate--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=gltX PE=3 SV=1 116 360 5.0E-10
sp|Q82U77|SYE_NITEU Glutamate--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gltX PE=3 SV=1 116 334 5.0E-10
sp|A2BPV5|SYE_PROMS Glutamate--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=gltX PE=3 SV=1 119 319 5.0E-10
sp|A5W968|GLUQ_PSEP1 Glutamyl-Q tRNA(Asp) synthetase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gluQ PE=3 SV=1 108 337 5.0E-10
sp|Q0HKH4|SYE_SHESM Glutamate--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=gltX PE=3 SV=1 118 334 5.0E-10
sp|A3D6C6|SYE_SHEB5 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gltX PE=3 SV=1 118 334 5.0E-10
sp|B1LUJ9|SYE1_METRJ Glutamate--tRNA ligase 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gltX1 PE=3 SV=1 116 399 5.0E-10
sp|Q055X5|SYE_LEPBL Glutamate--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gltX PE=3 SV=1 111 333 5.0E-10
sp|Q04PF0|SYE_LEPBJ Glutamate--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gltX PE=3 SV=1 111 333 5.0E-10
sp|Q0HWS6|SYE_SHESR Glutamate--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=gltX PE=3 SV=1 118 334 6.0E-10
sp|A0KV33|SYE_SHESA Glutamate--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=gltX PE=3 SV=1 118 334 6.0E-10
sp|Q8DLI5|SYE_THEEB Glutamate--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=gltX PE=1 SV=1 116 334 6.0E-10
sp|B3CRX8|SYE1_ORITI Glutamate--tRNA ligase 1 OS=Orientia tsutsugamushi (strain Ikeda) GN=gltX1 PE=3 SV=1 116 230 6.0E-10
sp|Q163X3|SYE2_ROSDO Glutamate--tRNA ligase 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gltX2 PE=3 SV=1 116 334 6.0E-10
sp|Q4AAJ3|SYE_MYCHJ Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=gltX PE=3 SV=2 116 341 6.0E-10
sp|A9W910|SYE1_METEP Glutamate--tRNA ligase 1 OS=Methylobacterium extorquens (strain PA1) GN=gltX1 PE=3 SV=1 116 399 6.0E-10
sp|Q3BR75|SYE_XANC5 Glutamate--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gltX PE=3 SV=1 118 340 6.0E-10
sp|Q5WVE0|SYE_LEGPL Glutamate--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=gltX PE=3 SV=1 116 325 6.0E-10
sp|Q9CDZ7|SYE_LACLA Glutamate--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gltX PE=3 SV=1 113 399 6.0E-10
sp|Q6N5R5|SYE_RHOPA Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gltX PE=3 SV=1 116 399 6.0E-10
sp|A9AXJ1|SYE_HERA2 Glutamate--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gltX PE=3 SV=1 118 337 7.0E-10
sp|A8LZ53|SYE_SALAI Glutamate--tRNA ligase OS=Salinispora arenicola (strain CNS-205) GN=gltX PE=3 SV=1 116 357 7.0E-10
sp|A6LEA1|SYE_PARD8 Glutamate--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gltX PE=3 SV=1 112 407 8.0E-10
sp|A4Y8D7|SYE_SHEPC Glutamate--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gltX PE=3 SV=1 118 334 8.0E-10
sp|A5V932|SYE1_SPHWW Glutamate--tRNA ligase 1 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gltX1 PE=3 SV=1 116 222 8.0E-10
sp|Q5ZU96|SYE_LEGPH Glutamate--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gltX PE=3 SV=2 116 325 8.0E-10
sp|A3DD54|SYE_CLOTH Glutamate--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=gltX PE=3 SV=1 117 334 8.0E-10
sp|Q8PIP8|SYE_XANAC Glutamate--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gltX PE=3 SV=1 118 325 8.0E-10
sp|A1RI52|SYE_SHESW Glutamate--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=gltX PE=3 SV=1 118 334 8.0E-10
sp|Q6KIT3|SYE_MYCMO Glutamate--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=gltX PE=3 SV=1 116 334 9.0E-10
sp|A7HY03|SYE2_PARL1 Glutamate--tRNA ligase 2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gltX2 PE=3 SV=1 114 334 9.0E-10
sp|B3QYR1|SYE_CHLT3 Glutamate--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gltX PE=3 SV=1 112 357 9.0E-10
sp|B1Z9T1|SYE1_METPB Glutamate--tRNA ligase 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gltX1 PE=3 SV=1 116 399 9.0E-10
sp|Q3ATL0|SYE_CHLCH Glutamate--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=gltX PE=3 SV=1 116 334 9.0E-10
sp|Q07ZL0|SYE_SHEFN Glutamate--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gltX PE=3 SV=1 118 334 1.0E-09
sp|Q0BDX9|SYE_BURCM Glutamate--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gltX PE=3 SV=1 114 334 1.0E-09
sp|A9HLD9|SYE2_GLUDA Glutamate--tRNA ligase 2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=gltX2 PE=3 SV=1 119 319 1.0E-09
sp|B1YSK3|SYE_BURA4 Glutamate--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=gltX PE=3 SV=1 114 334 1.0E-09
sp|A5CFB7|SYE2_ORITB Glutamate--tRNA ligase 2 OS=Orientia tsutsugamushi (strain Boryong) GN=gltX2 PE=3 SV=2 116 230 1.0E-09
sp|Q4UME8|SYE2_RICFE Glutamate--tRNA ligase 2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gltX2 PE=3 SV=1 116 230 1.0E-09
sp|A8F2B0|SYE2_RICM5 Glutamate--tRNA ligase 2 OS=Rickettsia massiliae (strain Mtu5) GN=gltX2 PE=3 SV=1 115 230 1.0E-09
sp|A8F197|SYE1_RICM5 Glutamate--tRNA ligase 1 OS=Rickettsia massiliae (strain Mtu5) GN=gltX1 PE=3 SV=1 116 329 1.0E-09
sp|A5ID69|SYE_LEGPC Glutamate--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=gltX PE=3 SV=1 116 325 1.0E-09
sp|Q4A8M4|SYE_MYCH7 Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=gltX PE=3 SV=2 116 341 1.0E-09
sp|A1WWI7|SYE2_HALHL Glutamate--tRNA ligase 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gltX2 PE=3 SV=1 116 335 1.0E-09
sp|Q601G1|SYE_MYCH2 Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=gltX PE=3 SV=1 116 341 1.0E-09
sp|B5Z716|SYE2_HELPG Glutamate--tRNA ligase 2 OS=Helicobacter pylori (strain G27) GN=gltX2 PE=3 SV=1 117 377 1.0E-09
sp|B0RQU0|SYE_XANCB Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gltX PE=3 SV=1 118 349 1.0E-09
sp|Q9F724|SYE_CHLTE Glutamate--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gltX PE=3 SV=2 116 357 1.0E-09
sp|Q5X3Z5|SYE_LEGPA Glutamate--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=gltX PE=3 SV=1 116 325 1.0E-09
sp|Q98LZ1|SYE2_RHILO Glutamate--tRNA ligase 2 OS=Rhizobium loti (strain MAFF303099) GN=gltX2 PE=3 SV=1 116 227 1.0E-09
sp|Q8CWN5|SYE_STRR6 Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gltX PE=3 SV=1 114 399 1.0E-09
sp|Q04IA3|SYE_STRP2 Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gltX PE=3 SV=1 114 399 1.0E-09
sp|A6X0R0|SYE2_OCHA4 Glutamate--tRNA ligase 2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gltX2 PE=3 SV=1 116 210 1.0E-09
sp|A6SX06|SYE_JANMA Glutamate--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=gltX PE=3 SV=1 116 339 1.0E-09
sp|Q9KGF6|SYE_BACHD Glutamate--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gltX PE=3 SV=1 116 370 2.0E-09
sp|Q888P9|GLUQ_PSESM Glutamyl-Q tRNA(Asp) synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gluQ PE=3 SV=1 117 337 2.0E-09
sp|B2G868|SYE_LACRJ Glutamate--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=gltX PE=3 SV=1 113 399 2.0E-09
sp|A5VKT4|SYE_LACRD Glutamate--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=gltX PE=3 SV=1 113 399 2.0E-09
sp|B3EFG9|SYE_CHLL2 Glutamate--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gltX PE=3 SV=1 116 357 2.0E-09
sp|Q97NG1|SYE_STRPN Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gltX PE=1 SV=1 114 399 2.0E-09
sp|B5E378|SYE_STRP4 Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gltX PE=3 SV=1 114 399 2.0E-09
sp|A9I219|SYE_BORPD Glutamate--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gltX PE=3 SV=1 109 334 2.0E-09
sp|A8GRM9|SYE1_RICRS Glutamate--tRNA ligase 1 OS=Rickettsia rickettsii (strain Sheila Smith) GN=gltX1 PE=3 SV=1 116 329 2.0E-09
sp|B0BX35|SYE1_RICRO Glutamate--tRNA ligase 1 OS=Rickettsia rickettsii (strain Iowa) GN=gltX1 PE=3 SV=1 116 329 2.0E-09
sp|Q5H2R3|SYE_XANOR Glutamate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=gltX PE=3 SV=1 118 356 2.0E-09
sp|B2SSC6|SYE_XANOP Glutamate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=gltX PE=3 SV=1 118 356 2.0E-09
sp|Q2P5M8|SYE_XANOM Glutamate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gltX PE=3 SV=1 118 356 2.0E-09
sp|Q8YH36|SYE2_BRUME Glutamate--tRNA ligase 2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gltX2 PE=3 SV=2 116 210 2.0E-09
sp|B0CGG7|SYE1_BRUSI Glutamate--tRNA ligase 1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gltX1 PE=3 SV=1 116 210 2.0E-09
sp|A5VQF9|SYE1_BRUO2 Glutamate--tRNA ligase 1 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gltX1 PE=3 SV=2 116 210 2.0E-09
sp|Q8G0S1|SYE1_BRUSU Glutamate--tRNA ligase 1 OS=Brucella suis biovar 1 (strain 1330) GN=gltX1 PE=3 SV=1 116 210 2.0E-09
sp|A9MB31|SYE1_BRUC2 Glutamate--tRNA ligase 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gltX1 PE=3 SV=1 116 210 2.0E-09
sp|Q8P7C5|SYE_XANCP Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gltX PE=3 SV=1 118 334 2.0E-09
sp|Q4UWS6|SYE_XANC8 Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gltX PE=3 SV=1 118 334 2.0E-09
sp|B0BQK7|SYE_ACTPJ Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gltX PE=3 SV=1 111 334 2.0E-09
sp|B3H248|SYE_ACTP7 Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gltX PE=3 SV=1 111 334 2.0E-09
sp|Q7M7L9|SYE1_WOLSU Glutamate--tRNA ligase 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=gltX1 PE=3 SV=1 116 335 2.0E-09
sp|Q57DB3|SYE1_BRUAB Glutamate--tRNA ligase 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=gltX1 PE=3 SV=1 116 210 2.0E-09
sp|Q2YQ56|SYE1_BRUA2 Glutamate--tRNA ligase 1 OS=Brucella abortus (strain 2308) GN=gltX1 PE=3 SV=1 116 210 2.0E-09
sp|B2S5M8|SYE1_BRUA1 Glutamate--tRNA ligase 1 OS=Brucella abortus (strain S19) GN=gltX1 PE=3 SV=1 116 210 2.0E-09
sp|Q3IZQ8|SYE2_RHOS4 Glutamate--tRNA ligase 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gltX2 PE=3 SV=1 116 404 2.0E-09
sp|Q2J816|SYE_FRASC Glutamate--tRNA ligase OS=Frankia sp. (strain CcI3) GN=gltX PE=3 SV=1 116 357 2.0E-09
sp|A8GPB2|SYE2_RICAH Glutamate--tRNA ligase 2 OS=Rickettsia akari (strain Hartford) GN=gltX2 PE=3 SV=1 115 230 2.0E-09
sp|P53662|SYE_MYCPU Glutamate--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=gltX PE=3 SV=1 114 334 2.0E-09
sp|A8H2J4|SYE_SHEPA Glutamate--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gltX PE=3 SV=1 116 334 2.0E-09
sp|A0LI05|SYE_SYNFM Glutamate--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=gltX PE=3 SV=1 116 399 2.0E-09
sp|A3N1S5|SYE_ACTP2 Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gltX PE=3 SV=1 111 334 2.0E-09
sp|B1M0I6|SYE2_METRJ Glutamate--tRNA ligase 2 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gltX2 PE=3 SV=1 117 183 2.0E-09
sp|Q2GDP4|SYE1_NEOSM Glutamate--tRNA ligase 1 OS=Neorickettsia sennetsu (strain Miyayama) GN=gltX1 PE=3 SV=1 116 222 2.0E-09
sp|O84451|SYE_CHLTR Glutamate--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gltX PE=3 SV=1 112 334 2.0E-09
sp|Q3KLQ4|SYE_CHLTA Glutamate--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gltX PE=3 SV=1 112 334 2.0E-09
sp|Q92IH2|SYE1_RICCN Glutamate--tRNA ligase 1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gltX1 PE=3 SV=1 116 329 2.0E-09
sp|B0TNB9|SYE_SHEHH Glutamate--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gltX PE=3 SV=1 116 334 3.0E-09
sp|Q2RWK3|SYE1_RHORT Glutamate--tRNA ligase 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gltX1 PE=3 SV=1 116 235 3.0E-09
sp|Q12L63|SYE_SHEDO Glutamate--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gltX PE=3 SV=1 118 334 3.0E-09
sp|A8GT27|SYE2_RICRS Glutamate--tRNA ligase 2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=gltX2 PE=3 SV=1 113 230 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0043039 tRNA aminoacylation Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0005737 cytoplasm Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006807 nitrogen compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0043038 amino acid activation No
GO:0032553 ribonucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:1901360 organic cyclic compound metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0044238 primary metabolic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0006139 nucleobase-containing compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1776
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5087
Ophiocordyceps australis map64 (Brazil) OphauB2|1746 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03110
Ophiocordyceps camponoti-rufipedis Ophun1|4751
Ophiocordyceps kimflemingae Ophio5|8103
Ophiocordyceps subramaniannii Hirsu2|1699

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1746
MKTDQLQALPAKLSGDFRSIEPHLRDLDKHLILRSYLDGYTLSELDRKTWQTLRANKVAIGFIRKNNLPHLTRWF
TFIEQAHPEVQDEAKAGGDGASKKAGAANYNLALQDTDKGVVTRFLPEPSGYLHIGHAKAALLSDYFGHVAYKGQ
MRLRLDDTNPAKESEEFQDSIVEDLALMGIKADSLTYTSDYFDFLYDKCKTLISMGKAYADDTDQETMRAQRMDG
IPSKHRDRGIDENLRIFEEMKKGSREGLTHCIRAKISADDPNKAMRDPVIYRCNINDAHHRTGRKWNMYPMYDFA
CPVVDSHEGVTHALRSTEYTDRNPQYQWFLDTLGLRQVHMWDFARMNFIRTFLSKRKLAKLVDTGKVWGWDDPRM
PTIRGVRRRGMTVAALRDFIIRQGPSRNVVVMDWTSFWNANKKEIDPVVPRHTALLNKDMVKVQLTGSQVPSSVV
VEQRPKHPKNPSVGTKDVVFSSQVYIDQADAKSFKAGEEITLMGWGNAFVRDLPTTDPITSMALELNLKGDFKAT
DKKITWLSAQGFDLVPAELWDFDYLITKDKLDEEDNVEDFLNPNTASMDEAWCDAGVGKLKTDDIVQLERRGFYR
VDKGLGDWKAGEAGEKGPRVVFFNIPTGKAK*
Coding >OphauB2|1746
ATGAAGACGGACCAGCTCCAGGCCCTGCCGGCCAAGCTCTCGGGCGACTTTCGATCCATTGAGCCGCACCTCCGA
GACTTGGACAAGCATCTCATCCTGCGCTCCTACCTCGATGGCTATACGCTTAGCGAGCTGGATAGGAAAACGTGG
CAGACGTTGCGGGCGAACAAGGTGGCCATTGGCTTCATCAGGAAGAACAACTTGCCGCACTTGACGCGATGGTTC
ACGTTTATCGAGCAGGCCCATCCCGAGGTGCAAGACGAGGCCAAGGCTGGCGGCGACGGCGCCTCGAAAAAGGCG
GGCGCGGCAAATTACAATCTTGCTCTGCAAGACACGGACAAGGGCGTCGTGACGCGCTTCTTGCCTGAGCCATCT
GGTTACCTTCACATTGGACATGCCAAGGCGGCCCTTCTGAGCGACTACTTTGGCCATGTTGCCTACAAGGGCCAG
ATGCGCCTCCGCCTAGACGACACCAACCCTGCCAAGGAGAGTGAAGAGTTTCAGGACTCGATTGTTGAGGATTTG
GCACTCATGGGCATCAAGGCCGACTCTCTCACCTACACGTCGGACTACTTTGACTTTTTGTACGACAAGTGCAAG
ACGCTCATTTCCATGGGCAAGGCATATGCCGACGATACAGACCAGGAAACGATGCGCGCCCAGCGCATGGACGGC
ATTCCGTCCAAGCACCGCGACCGTGGGATTGACGAGAATCTACGCATCTTTGAAGAGATGAAGAAGGGCTCTCGT
GAGGGCTTGACGCACTGCATCCGCGCCAAAATCTCGGCCGACGACCCCAACAAGGCGATGCGAGATCCCGTCATT
TATCGCTGCAATATTAATGACGCGCACCACCGGACAGGACGCAAGTGGAACATGTACCCAATGTACGACTTTGCC
TGCCCCGTTGTCGACAGCCACGAGGGCGTGACGCATGCTCTGCGATCAACGGAATACACGGACCGCAATCCGCAG
TACCAATGGTTTCTCGACACGCTGGGGCTGCGCCAGGTGCACATGTGGGACTTTGCGCGCATGAACTTTATCCGC
ACCTTTCTCTCCAAGCGCAAGCTGGCCAAGCTGGTGGACACGGGCAAGGTATGGGGCTGGGATGATCCGCGGATG
CCCACGATTCGAGGCGTGCGGCGGCGCGGCATGACAGTGGCGGCCCTACGCGACTTTATCATCCGACAGGGCCCT
AGCCGCAACGTGGTGGTGATGGACTGGACCAGCTTCTGGAATGCCAACAAGAAGGAAATCGACCCGGTAGTCCCG
CGACACACTGCTCTCTTGAACAAGGACATGGTCAAGGTGCAGCTGACGGGGTCTCAAGTGCCGTCGTCGGTCGTG
GTTGAGCAGAGGCCCAAGCATCCCAAGAATCCAAGCGTGGGCACCAAGGACGTTGTCTTTTCATCCCAAGTCTAC
ATTGACCAGGCTGATGCCAAGAGCTTCAAGGCTGGAGAAGAGATTACGCTCATGGGTTGGGGCAACGCCTTTGTA
CGCGACTTGCCGACAACAGACCCCATTACCAGCATGGCGCTCGAGCTCAATCTCAAGGGCGACTTCAAGGCGACG
GACAAGAAGATTACTTGGCTATCGGCACAGGGCTTTGACCTGGTTCCTGCCGAGCTGTGGGACTTTGACTACCTC
ATCACCAAGGACAAGCTGGACGAAGAGGACAATGTGGAAGACTTTTTGAACCCCAACACGGCGAGCATGGACGAG
GCGTGGTGCGATGCGGGCGTGGGCAAGCTCAAGACCGACGACATTGTGCAGCTGGAGCGCCGGGGCTTTTACCGT
GTCGACAAGGGGCTTGGGGATTGGAAGGCGGGAGAGGCGGGAGAAAAGGGGCCGCGGGTGGTGTTTTTCAACATT
CCCACGGGCAAGGCAAAGTAG
Transcript >OphauB2|1746
ATGAAGACGGACCAGCTCCAGGCCCTGCCGGCCAAGCTCTCGGGCGACTTTCGATCCATTGAGCCGCACCTCCGA
GACTTGGACAAGCATCTCATCCTGCGCTCCTACCTCGATGGCTATACGCTTAGCGAGCTGGATAGGAAAACGTGG
CAGACGTTGCGGGCGAACAAGGTGGCCATTGGCTTCATCAGGAAGAACAACTTGCCGCACTTGACGCGATGGTTC
ACGTTTATCGAGCAGGCCCATCCCGAGGTGCAAGACGAGGCCAAGGCTGGCGGCGACGGCGCCTCGAAAAAGGCG
GGCGCGGCAAATTACAATCTTGCTCTGCAAGACACGGACAAGGGCGTCGTGACGCGCTTCTTGCCTGAGCCATCT
GGTTACCTTCACATTGGACATGCCAAGGCGGCCCTTCTGAGCGACTACTTTGGCCATGTTGCCTACAAGGGCCAG
ATGCGCCTCCGCCTAGACGACACCAACCCTGCCAAGGAGAGTGAAGAGTTTCAGGACTCGATTGTTGAGGATTTG
GCACTCATGGGCATCAAGGCCGACTCTCTCACCTACACGTCGGACTACTTTGACTTTTTGTACGACAAGTGCAAG
ACGCTCATTTCCATGGGCAAGGCATATGCCGACGATACAGACCAGGAAACGATGCGCGCCCAGCGCATGGACGGC
ATTCCGTCCAAGCACCGCGACCGTGGGATTGACGAGAATCTACGCATCTTTGAAGAGATGAAGAAGGGCTCTCGT
GAGGGCTTGACGCACTGCATCCGCGCCAAAATCTCGGCCGACGACCCCAACAAGGCGATGCGAGATCCCGTCATT
TATCGCTGCAATATTAATGACGCGCACCACCGGACAGGACGCAAGTGGAACATGTACCCAATGTACGACTTTGCC
TGCCCCGTTGTCGACAGCCACGAGGGCGTGACGCATGCTCTGCGATCAACGGAATACACGGACCGCAATCCGCAG
TACCAATGGTTTCTCGACACGCTGGGGCTGCGCCAGGTGCACATGTGGGACTTTGCGCGCATGAACTTTATCCGC
ACCTTTCTCTCCAAGCGCAAGCTGGCCAAGCTGGTGGACACGGGCAAGGTATGGGGCTGGGATGATCCGCGGATG
CCCACGATTCGAGGCGTGCGGCGGCGCGGCATGACAGTGGCGGCCCTACGCGACTTTATCATCCGACAGGGCCCT
AGCCGCAACGTGGTGGTGATGGACTGGACCAGCTTCTGGAATGCCAACAAGAAGGAAATCGACCCGGTAGTCCCG
CGACACACTGCTCTCTTGAACAAGGACATGGTCAAGGTGCAGCTGACGGGGTCTCAAGTGCCGTCGTCGGTCGTG
GTTGAGCAGAGGCCCAAGCATCCCAAGAATCCAAGCGTGGGCACCAAGGACGTTGTCTTTTCATCCCAAGTCTAC
ATTGACCAGGCTGATGCCAAGAGCTTCAAGGCTGGAGAAGAGATTACGCTCATGGGTTGGGGCAACGCCTTTGTA
CGCGACTTGCCGACAACAGACCCCATTACCAGCATGGCGCTCGAGCTCAATCTCAAGGGCGACTTCAAGGCGACG
GACAAGAAGATTACTTGGCTATCGGCACAGGGCTTTGACCTGGTTCCTGCCGAGCTGTGGGACTTTGACTACCTC
ATCACCAAGGACAAGCTGGACGAAGAGGACAATGTGGAAGACTTTTTGAACCCCAACACGGCGAGCATGGACGAG
GCGTGGTGCGATGCGGGCGTGGGCAAGCTCAAGACCGACGACATTGTGCAGCTGGAGCGCCGGGGCTTTTACCGT
GTCGACAAGGGGCTTGGGGATTGGAAGGCGGGAGAGGCGGGAGAAAAGGGGCCGCGGGTGGTGTTTTTCAACATT
CCCACGGGCAAGGCAAAGTAG
Gene >OphauB2|1746
ATGAAGACGGACCAGCTCCAGGCCCTGCCGGCCAAGCTCTCGGGCGACTTTCGATCCATTGAGCCGCACCTCCGA
GACTTGGACAAGCATCTCATCCTGCGCTCCTACCTCGATGGCTATACGCTTAGCGAGCTGGATAGGAAAACGTGG
CAGACGTTGCGGGCGAACAAGGTGGCCATTGGCTTCATCAGGAAGAACAACTTGCCGCACTTGACGCGATGGTTC
ACGTTTATCGAGCAGGCCCATCCCGAGGTGCAAGACGAGGCCAAGGCTGGCGGCGACGGCGCCTCGAAAAAGGCG
GGCGCGGCAAATTACAATCTTGCTCTGCAAGACACGGACAAGGGCGTCGTGACGCGCTTCTTGCCTGAGCCATCG
TGAGTATGCTCCATGTCGTATTGCGAGACGTGGTTGATTGACGGGGCACGGGCTAGTGGTTACCTTCACATTGGA
CATGCCAAGGCGGCCCTTCTGAGCGACTACTTTGGCCATGTTGCCTACAAGGGCCAGATGCGCCTCCGCCTAGAC
GACACCAACCCTGCCAAGGAGAGTGAAGAGTTTCAGGACTCGATTGTTGAGGATTTGGCACTCATGGGCATCAAG
GCCGACTCTCTCACCTACACGTCGGACTACTTTGACTTTTTGTACGACAAGTGCAAGACGCTCATTTCCATGGGC
AAGGCATATGCCGACGATACAGACCAGGAAACGATGCGCGCCCAGCGCATGGACGGCATTCCGTCCAAGCACCGC
GACCGTGGGATTGACGAGAATCTACGCATCTTTGAAGAGATGAAGAAGGGCTCTCGTGAGGGCTTGACGCACTGC
ATCCGCGCCAAAATCTCGGCCGACGACCCCAACAAGGCGATGCGAGATCCCGTCATTTATCGCTGCAATATTAAT
GACGCGCACCACCGGACAGGACGCAAGTGGAACATGTACCCAATGTACGACTTTGCCTGCCCCGTTGTCGACAGC
CACGAGGGCGTGACGCATGCTCTGCGATCAACGGAATACACGGACCGCAATCCGCAGTACCAATGGTTTCTCGAC
ACGCTGGGGCTGCGCCAGGTGCACATGTGGGACTTTGCGCGCATGAACTTTATCCGCACCTTTCTCTCCAAGCGC
AAGCTGGCCAAGCTGGTGGACACGGGCAAGGTATGGGGCTGGGATGATCCGCGGATGCCCACGATTCGAGGCGTG
CGGCGGCGCGGCATGACAGTGGCGGCCCTACGCGACTTTATCATCCGACAGGGCCCTAGCCGCAACGTGGTGGTG
ATGGACTGGACCAGCTTCTGGAATGCCAACAAGAAGGAAATCGACCCGGTAGTCCCGCGACACACTGCTCTCTTG
AACAAGGACATGGTCAAGGTGCAGCTGACGGGGTCTCAAGTGCCGTCGTCGGTCGTGGTTGAGCAGAGGCCCAAG
CATCCCAAGAATCCAAGCGTGGGCACCAAGGACGTTGTCTTTTCATCCCAAGTCTACATTGACCAGGCTGATGCC
AAGAGCTTCAAGGCTGGAGAAGAGATTACGCTCATGGGTTGGGGCAACGCCTTTGTACGCGACTTGCCGACAACA
GACCCCATTACCAGCATGGCGCTCGAGCTCAATCTCAAGGGCGACTTCAAGGCGACGGACAAGAAGATTACTTGG
CTATCGGCACAGGGCTTTGACCTGGTTCCTGCCGAGCTGTGGGACTTTGACTACCTCATCACCAAGGACAAGCTG
GACGAAGAGGACAATGTGGAAGACTTTTTGAACCCCAACACGGCGAGCATGGACGAGGCGTGGTGCGATGCGGGC
GTGGGCAAGCTCAAGACCGACGACATTGTGCAGCTGGAGCGCCGGGGCTTTTACCGTGTCGACAAGGGGCTTGGG
GATTGGAAGGCGGGAGAGGCGGGAGAAAAGGGGCCGCGGGTGGTGTTTTTCAACATTCCCACGGGCAAGGCAAAG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail