Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1745
Gene name
LocationContig_15:90870..91764
Strand+
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01975 SurE Survival protein SurE 1.6E-31 19 227

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30887|PHO2_YARLI Acid phosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO2 PE=3 SV=2 19 269 2.0E-15
sp|C4XNX3|SURE_DESMR 5'-nucleotidase SurE OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=surE PE=3 SV=1 18 268 6.0E-12
sp|Q0W2Q3|SURE_METAR 5'-nucleotidase SurE OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=surE PE=3 SV=1 18 221 1.0E-11
sp|B0K177|SURE_THEPX 5'-nucleotidase SurE OS=Thermoanaerobacter sp. (strain X514) GN=surE PE=3 SV=1 122 218 2.0E-11
sp|B0K9J0|SURE_THEP3 5'-nucleotidase SurE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=surE PE=3 SV=1 122 218 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30887|PHO2_YARLI Acid phosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO2 PE=3 SV=2 19 269 2.0E-15
sp|C4XNX3|SURE_DESMR 5'-nucleotidase SurE OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=surE PE=3 SV=1 18 268 6.0E-12
sp|Q0W2Q3|SURE_METAR 5'-nucleotidase SurE OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=surE PE=3 SV=1 18 221 1.0E-11
sp|B0K177|SURE_THEPX 5'-nucleotidase SurE OS=Thermoanaerobacter sp. (strain X514) GN=surE PE=3 SV=1 122 218 2.0E-11
sp|B0K9J0|SURE_THEP3 5'-nucleotidase SurE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=surE PE=3 SV=1 122 218 2.0E-11
sp|A5FK02|SURE_FLAJ1 5'-nucleotidase SurE OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=surE PE=3 SV=1 91 223 3.0E-11
sp|B3CLR5|SURE_WOLPP 5'-nucleotidase SurE OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=surE PE=3 SV=1 19 214 5.0E-11
sp|A4SYE9|SURE_POLSQ 5'-nucleotidase SurE OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=surE PE=3 SV=1 18 241 9.0E-11
sp|B0JX00|SURE_MICAN 5'-nucleotidase SurE OS=Microcystis aeruginosa (strain NIES-843) GN=surE PE=3 SV=1 19 214 9.0E-11
sp|Q73G84|SURE_WOLPM 5'-nucleotidase SurE OS=Wolbachia pipientis wMel GN=surE PE=3 SV=1 19 214 1.0E-10
sp|A0M5L6|SURE_GRAFK 5'-nucleotidase SurE OS=Gramella forsetii (strain KT0803) GN=surE PE=3 SV=1 19 223 2.0E-10
sp|Q3YSH3|SURE_EHRCJ 5'-nucleotidase SurE OS=Ehrlichia canis (strain Jake) GN=surE PE=3 SV=1 19 214 2.0E-10
sp|Q9RRT8|SURE_DEIRA 5'-nucleotidase SurE OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=surE PE=3 SV=1 122 235 2.0E-10
sp|C0R4G7|SURE_WOLWR 5'-nucleotidase SurE OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=surE PE=3 SV=1 19 214 3.0E-10
sp|Q39FP8|SURE2_BURL3 5'-nucleotidase SurE 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=surE2 PE=3 SV=1 19 233 5.0E-10
sp|Q3MB98|SURE_ANAVT 5'-nucleotidase SurE OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=surE PE=3 SV=1 19 214 5.0E-10
sp|B8FC91|SURE_DESAA 5'-nucleotidase SurE OS=Desulfatibacillum alkenivorans (strain AK-01) GN=surE PE=3 SV=1 18 214 6.0E-10
sp|Q7NNG7|SURE_GLOVI 5'-nucleotidase SurE OS=Gloeobacter violaceus (strain PCC 7421) GN=surE PE=3 SV=1 18 218 6.0E-10
sp|A6Q9V0|SURE_SULNB 5'-nucleotidase SurE OS=Sulfurovum sp. (strain NBC37-1) GN=surE PE=3 SV=1 115 227 6.0E-10
sp|Q5N0F0|SURE_SYNP6 5'-nucleotidase SurE OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=surE PE=3 SV=1 19 214 8.0E-10
sp|Q31LH6|SURE_SYNE7 5'-nucleotidase SurE OS=Synechococcus elongatus (strain PCC 7942) GN=surE PE=3 SV=1 19 214 8.0E-10
sp|A6L1M6|SURE_BACV8 5'-nucleotidase SurE OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=surE PE=3 SV=1 19 214 8.0E-10
sp|Q8YMT3|SURE_NOSS1 5'-nucleotidase SurE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=surE PE=3 SV=1 19 214 1.0E-09
sp|A9BBN4|SURE_PROM4 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9211) GN=surE PE=3 SV=1 19 166 2.0E-09
sp|A7HXK5|SURE_PARL1 5'-nucleotidase SurE OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=surE PE=3 SV=1 12 214 2.0E-09
sp|P74709|SURE_SYNY3 5'-nucleotidase SurE OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=surE PE=3 SV=1 18 166 2.0E-09
sp|Q8Y040|SURE_RALSO 5'-nucleotidase SurE OS=Ralstonia solanacearum (strain GMI1000) GN=surE PE=3 SV=1 18 241 2.0E-09
sp|Q2L006|SURE_BORA1 5'-nucleotidase SurE OS=Bordetella avium (strain 197N) GN=surE PE=3 SV=1 18 218 3.0E-09
sp|A7H0A1|SURE_CAMC5 5'-nucleotidase SurE OS=Campylobacter curvus (strain 525.92) GN=surE PE=3 SV=1 122 280 3.0E-09
sp|B1WXT3|SURE_CYAA5 5'-nucleotidase SurE OS=Cyanothece sp. (strain ATCC 51142) GN=surE PE=3 SV=1 16 232 4.0E-09
sp|A6VUV4|SURE_MARMS 5'-nucleotidase SurE OS=Marinomonas sp. (strain MWYL1) GN=surE PE=3 SV=1 19 214 4.0E-09
sp|A5D2G6|SURE_PELTS 5'-nucleotidase SurE OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=surE PE=3 SV=1 18 229 4.0E-09
sp|Q0IC13|SURE_SYNS3 5'-nucleotidase SurE OS=Synechococcus sp. (strain CC9311) GN=surE PE=3 SV=1 18 234 4.0E-09
sp|Q46ZH1|SURE_CUPPJ 5'-nucleotidase SurE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=surE PE=3 SV=1 18 214 4.0E-09
sp|Q390V3|SURE1_BURL3 5'-nucleotidase SurE 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=surE1 PE=3 SV=1 18 214 5.0E-09
sp|A1V4L3|SURE_BURMS 5'-nucleotidase SurE OS=Burkholderia mallei (strain SAVP1) GN=surE PE=3 SV=1 19 233 5.0E-09
sp|Q62JV2|SURE_BURMA 5'-nucleotidase SurE OS=Burkholderia mallei (strain ATCC 23344) GN=surE PE=3 SV=1 19 233 5.0E-09
sp|A2S290|SURE_BURM9 5'-nucleotidase SurE OS=Burkholderia mallei (strain NCTC 10229) GN=surE PE=3 SV=1 19 233 5.0E-09
sp|A3MK87|SURE_BURM7 5'-nucleotidase SurE OS=Burkholderia mallei (strain NCTC 10247) GN=surE PE=3 SV=1 19 233 5.0E-09
sp|A3NA65|SURE_BURP6 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 668) GN=surE PE=3 SV=1 19 233 5.0E-09
sp|Q5GS87|SURE_WOLTR 5'-nucleotidase SurE OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=surE PE=3 SV=1 19 177 5.0E-09
sp|A4JEQ1|SURE_BURVG 5'-nucleotidase SurE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=surE PE=3 SV=1 19 233 6.0E-09
sp|A2C436|SURE_PROM1 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain NATL1A) GN=surE PE=3 SV=1 19 234 8.0E-09
sp|Q63UU4|SURE_BURPS 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain K96243) GN=surE PE=3 SV=1 19 233 8.0E-09
sp|Q3JRP0|SURE_BURP1 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 1710b) GN=surE PE=3 SV=1 19 233 8.0E-09
sp|A3NVY2|SURE_BURP0 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 1106a) GN=surE PE=3 SV=1 19 233 8.0E-09
sp|Q46JK0|SURE_PROMT 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain NATL2A) GN=surE PE=3 SV=1 19 234 1.0E-08
sp|Q8DI06|SURE_THEEB 5'-nucleotidase SurE OS=Thermosynechococcus elongatus (strain BP-1) GN=surE PE=3 SV=1 18 214 1.0E-08
sp|A0L4K6|SURE_MAGMM 5'-nucleotidase SurE OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=surE PE=3 SV=1 19 228 1.0E-08
sp|Q1ATN8|SURE_RUBXD 5'-nucleotidase SurE OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=surE PE=3 SV=2 18 233 1.0E-08
sp|Q0K950|SURE_CUPNH 5'-nucleotidase SurE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=surE PE=3 SV=1 18 214 1.0E-08
sp|Q2SWF5|SURE_BURTA 5'-nucleotidase SurE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=surE PE=3 SV=1 19 214 1.0E-08
sp|Q10YV3|SURE_TRIEI 5'-nucleotidase SurE OS=Trichodesmium erythraeum (strain IMS101) GN=surE PE=3 SV=1 19 218 2.0E-08
sp|B3R1L4|SURE_CUPTR 5'-nucleotidase SurE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=surE PE=3 SV=1 18 214 2.0E-08
sp|B8HSQ9|SURE_CYAP4 5'-nucleotidase SurE OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=surE PE=3 SV=1 19 214 2.0E-08
sp|Q72H70|SURE1_THET2 5'-nucleotidase SurE 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=surE1 PE=3 SV=1 18 235 2.0E-08
sp|A6H213|SURE_FLAPJ 5'-nucleotidase SurE OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=surE PE=3 SV=1 122 223 2.0E-08
sp|Q8YSE9|Y3139_NOSS1 Putative 5'-nucleotidase alr3139 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3139 PE=3 SV=1 19 227 2.0E-08
sp|Q5HWH7|SURE_CAMJR 5'-nucleotidase SurE OS=Campylobacter jejuni (strain RM1221) GN=surE PE=3 SV=1 18 214 2.0E-08
sp|Q9PIK6|SURE_CAMJE 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=surE PE=3 SV=1 18 214 2.0E-08
sp|A8FK82|SURE_CAMJ8 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=surE PE=3 SV=1 18 214 2.0E-08
sp|Q7MHQ7|SURE_VIBVY 5'-nucleotidase SurE OS=Vibrio vulnificus (strain YJ016) GN=surE PE=3 SV=1 19 214 2.0E-08
sp|A1VY14|SURE_CAMJJ 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=surE PE=3 SV=1 18 214 2.0E-08
sp|Q67NP4|SURE_SYMTH 5'-nucleotidase SurE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=surE PE=3 SV=1 97 233 3.0E-08
sp|Q8DC57|SURE_VIBVU 5'-nucleotidase SurE OS=Vibrio vulnificus (strain CMCP6) GN=surE PE=3 SV=1 19 214 3.0E-08
sp|A8EX03|SURE_ARCB4 5'-nucleotidase SurE OS=Arcobacter butzleri (strain RM4018) GN=surE PE=3 SV=1 18 217 3.0E-08
sp|Q319M0|SURE_PROM9 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9312) GN=surE PE=3 SV=1 15 222 3.0E-08
sp|B8J2G2|SURE_DESDA 5'-nucleotidase SurE OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=surE PE=3 SV=1 19 195 3.0E-08
sp|O67004|SURE_AQUAE 5'-nucleotidase SurE OS=Aquifex aeolicus (strain VF5) GN=surE PE=1 SV=1 23 218 4.0E-08
sp|A8F523|SURE_PSELT 5'-nucleotidase SurE OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=surE PE=3 SV=1 19 215 4.0E-08
sp|A1ASL7|SURE_PELPD 5'-nucleotidase SurE OS=Pelobacter propionicus (strain DSM 2379) GN=surE PE=3 SV=1 18 214 4.0E-08
sp|Q87LQ5|SURE_VIBPA 5'-nucleotidase SurE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=surE PE=3 SV=1 19 204 4.0E-08
sp|B2U9T8|SURE_RALPJ 5'-nucleotidase SurE OS=Ralstonia pickettii (strain 12J) GN=surE PE=3 SV=1 18 241 5.0E-08
sp|A2BLQ8|SURE_HYPBU 5'-nucleotidase SurE OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=surE PE=3 SV=1 14 223 6.0E-08
sp|B1JB30|SURE_PSEPW 5'-nucleotidase SurE OS=Pseudomonas putida (strain W619) GN=surE PE=3 SV=1 19 214 7.0E-08
sp|Q2FLE8|SURE_METHJ 5'-nucleotidase SurE OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=surE PE=3 SV=1 121 214 7.0E-08
sp|A4G4J2|SURE_HERAR 5'-nucleotidase SurE OS=Herminiimonas arsenicoxydans GN=surE PE=3 SV=1 19 214 7.0E-08
sp|A4TQ00|SURE_YERPP 5'/3'-nucleotidase SurE OS=Yersinia pestis (strain Pestoides F) GN=surE PE=3 SV=1 18 214 8.0E-08
sp|Q1CLR3|SURE_YERPN 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=surE PE=3 SV=1 18 214 8.0E-08
sp|A9R116|SURE_YERPG 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=surE PE=3 SV=1 18 214 8.0E-08
sp|Q8ZBP9|SURE_YERPE 5'/3'-nucleotidase SurE OS=Yersinia pestis GN=surE PE=3 SV=1 18 214 8.0E-08
sp|Q1C475|SURE_YERPA 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=surE PE=3 SV=1 18 214 8.0E-08
sp|B7KB74|SURE_CYAP7 5'-nucleotidase SurE OS=Cyanothece sp. (strain PCC 7424) GN=surE PE=3 SV=1 19 217 8.0E-08
sp|B1JJF5|SURE_YERPY 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=surE PE=3 SV=1 18 214 8.0E-08
sp|Q66EC0|SURE_YERPS 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=surE PE=3 SV=1 18 214 8.0E-08
sp|B2K580|SURE_YERPB 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=surE PE=3 SV=1 18 214 8.0E-08
sp|A7FLX5|SURE_YERP3 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=surE PE=3 SV=1 18 214 8.0E-08
sp|A1JJT7|SURE_YERE8 5'/3'-nucleotidase SurE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=surE PE=3 SV=1 18 214 9.0E-08
sp|Q7M8G1|SURE_WOLSU 5'-nucleotidase SurE OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=surE PE=3 SV=1 19 214 9.0E-08
sp|A0LHG0|SURE_SYNFM 5'-nucleotidase SurE OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=surE PE=3 SV=1 19 214 1.0E-07
sp|Q7U5U4|SURE_SYNPX 5'-nucleotidase SurE OS=Synechococcus sp. (strain WH8102) GN=surE PE=3 SV=1 18 234 1.0E-07
sp|B9M4Z4|SURE_GEODF 5'-nucleotidase SurE OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=surE PE=3 SV=1 122 214 1.0E-07
sp|Q1MQB1|SURE_LAWIP 5'-nucleotidase SurE OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=surE PE=3 SV=1 19 214 2.0E-07
sp|B1I3V7|SURE_DESAP 5'-nucleotidase SurE OS=Desulforudis audaxviator (strain MP104C) GN=surE PE=3 SV=1 18 166 2.0E-07
sp|B8IN19|SURE_METNO 5'-nucleotidase SurE OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=surE PE=3 SV=1 18 214 2.0E-07
sp|C4LBQ6|SURE_TOLAT 5'-nucleotidase SurE OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=surE PE=3 SV=1 19 163 2.0E-07
sp|B1XPE2|SURE_SYNP2 5'-nucleotidase SurE OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=surE PE=3 SV=1 19 218 2.0E-07
sp|O27484|SURE_METTH 5'-nucleotidase SurE OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=surE PE=3 SV=1 120 216 2.0E-07
sp|A2SQ45|SURE_METLZ 5'-nucleotidase SurE OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=surE PE=3 SV=1 122 217 2.0E-07
sp|Q7V0I6|SURE_PROMP 5'-nucleotidase SurE OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=surE PE=3 SV=1 15 222 2.0E-07
sp|A2BXX8|SURE_PROM5 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9515) GN=surE PE=3 SV=1 15 222 2.0E-07
sp|B1LXR9|SURE_METRJ 5'-nucleotidase SurE OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=surE PE=3 SV=1 18 214 3.0E-07
sp|Q7W670|SURE_BORPA 5'-nucleotidase SurE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=surE PE=3 SV=1 19 218 3.0E-07
sp|Q7WI36|SURE_BORBR 5'-nucleotidase SurE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=surE PE=3 SV=1 19 218 3.0E-07
sp|Q7VAV8|SURE_PROMA 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=surE PE=3 SV=1 18 233 3.0E-07
sp|A5EY39|SURE_DICNV 5'-nucleotidase SurE OS=Dichelobacter nodosus (strain VCS1703A) GN=surE PE=3 SV=1 19 214 3.0E-07
sp|Q11HC9|SURE_CHESB 5'-nucleotidase SurE OS=Chelativorans sp. (strain BNC1) GN=surE PE=3 SV=1 120 224 3.0E-07
sp|Q30YV9|SURE_DESAG 5'-nucleotidase SurE OS=Desulfovibrio alaskensis (strain G20) GN=surE PE=3 SV=1 19 250 3.0E-07
sp|B8CWH0|SURE_HALOH 5'-nucleotidase SurE OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=surE PE=3 SV=1 18 214 3.0E-07
sp|C5CUL9|SURE_VARPS 5'-nucleotidase SurE OS=Variovorax paradoxus (strain S110) GN=surE PE=3 SV=1 19 214 4.0E-07
sp|A5CVV1|SURE_VESOH 5'-nucleotidase SurE OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=surE PE=3 SV=1 19 214 4.0E-07
sp|A1S4E2|SURE_SHEAM 5'-nucleotidase SurE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=surE PE=3 SV=1 19 214 4.0E-07
sp|A3PIZ9|SURE_RHOS1 5'-nucleotidase SurE OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=surE PE=3 SV=1 122 214 4.0E-07
sp|B9KQZ2|SURE_RHOSK 5'-nucleotidase SurE OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=surE PE=3 SV=1 122 214 4.0E-07
sp|Q3J3D0|SURE_RHOS4 5'-nucleotidase SurE OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=surE PE=3 SV=1 122 214 4.0E-07
sp|Q15P28|SURE_PSEA6 5'-nucleotidase SurE OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=surE PE=3 SV=1 19 214 5.0E-07
sp|Q39VS1|SURE_GEOMG 5'-nucleotidase SurE OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=surE PE=3 SV=1 95 214 5.0E-07
sp|Q7VXN2|SURE_BORPE 5'-nucleotidase SurE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=surE PE=3 SV=1 19 218 5.0E-07
sp|Q6LMT6|SURE_PHOPR 5'-nucleotidase SurE OS=Photobacterium profundum GN=surE PE=3 SV=2 19 233 6.0E-07
sp|Q3JCZ4|SURE_NITOC 5'-nucleotidase SurE OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=surE PE=3 SV=1 18 227 7.0E-07
sp|A7ZCD9|SURE_CAMC1 5'-nucleotidase SurE OS=Campylobacter concisus (strain 13826) GN=surE PE=3 SV=1 122 227 8.0E-07
sp|Q5HBM5|SURE_EHRRW 5'-nucleotidase SurE OS=Ehrlichia ruminantium (strain Welgevonden) GN=surE PE=3 SV=1 18 163 8.0E-07
sp|Q5FHG1|SURE_EHRRG 5'-nucleotidase SurE OS=Ehrlichia ruminantium (strain Gardel) GN=surE PE=3 SV=2 18 163 8.0E-07
sp|A5IBD5|SURE_LEGPC 5'-nucleotidase SurE OS=Legionella pneumophila (strain Corby) GN=surE PE=3 SV=1 19 214 8.0E-07
sp|A8ZXL1|SURE_DESOH 5'-nucleotidase SurE OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=surE PE=3 SV=1 19 214 8.0E-07
sp|Q604W8|SURE_METCA 5'-nucleotidase SurE OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=surE PE=3 SV=1 18 214 9.0E-07
sp|B9JXD7|SURE_AGRVS 5'-nucleotidase SurE OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=surE PE=3 SV=1 18 214 1.0E-06
sp|Q5X5S5|SURE_LEGPA 5'-nucleotidase SurE OS=Legionella pneumophila (strain Paris) GN=surE PE=3 SV=1 19 214 1.0E-06
sp|Q9S4T3|SURE_LEGPH 5'-nucleotidase SurE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=surE PE=3 SV=1 19 214 1.0E-06
sp|B1ZJ09|SURE_METPB 5'-nucleotidase SurE OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=surE PE=3 SV=1 18 214 1.0E-06
sp|Q2RJD1|SURE_MOOTA 5'-nucleotidase SurE OS=Moorella thermoacetica (strain ATCC 39073) GN=surE PE=3 SV=1 97 214 1.0E-06
sp|Q6MCW1|SURE_PARUW 5'-nucleotidase SurE OS=Protochlamydia amoebophila (strain UWE25) GN=surE PE=3 SV=1 97 215 1.0E-06
sp|C3MBU3|SURE_RHISN 5'-nucleotidase SurE OS=Rhizobium sp. (strain NGR234) GN=surE PE=3 SV=1 120 214 1.0E-06
sp|Q47D24|SURE_DECAR 5'-nucleotidase SurE OS=Dechloromonas aromatica (strain RCB) GN=surE PE=3 SV=1 18 214 1.0E-06
sp|A1VQF4|SURE_POLNA 5'-nucleotidase SurE OS=Polaromonas naphthalenivorans (strain CJ2) GN=surE PE=3 SV=1 89 227 1.0E-06
sp|Q1J2E1|SURE_DEIGD 5'-nucleotidase SurE OS=Deinococcus geothermalis (strain DSM 11300) GN=surE PE=3 SV=1 122 235 1.0E-06
sp|Q5WX53|SURE_LEGPL 5'-nucleotidase SurE OS=Legionella pneumophila (strain Lens) GN=surE PE=3 SV=1 19 214 1.0E-06
sp|A9IP06|SURE_BORPD 5'-nucleotidase SurE OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=surE PE=3 SV=1 18 214 2.0E-06
sp|A3PEA4|SURE_PROM0 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9301) GN=surE PE=3 SV=1 18 233 2.0E-06
sp|A0KGH8|SURE_AERHH 5'-nucleotidase SurE OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=surE PE=3 SV=1 19 214 2.0E-06
sp|B0C6V3|SURE_ACAM1 5'-nucleotidase SurE OS=Acaryochloris marina (strain MBIC 11017) GN=surE PE=3 SV=1 19 214 2.0E-06
sp|A2SF75|SURE_METPP 5'-nucleotidase SurE OS=Methylibium petroleiphilum (strain PM1) GN=surE PE=3 SV=2 96 214 2.0E-06
sp|Q3AVE5|SURE_SYNS9 5'-nucleotidase SurE OS=Synechococcus sp. (strain CC9902) GN=surE PE=3 SV=1 18 234 2.0E-06
sp|A4J5D2|SURE_DESRM 5'-nucleotidase SurE OS=Desulfotomaculum reducens (strain MI-1) GN=surE PE=3 SV=1 19 214 2.0E-06
sp|Q12PY9|SURE_SHEDO 5'-nucleotidase SurE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=surE PE=3 SV=1 18 214 2.0E-06
sp|A8G678|SURE_PROM2 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9215) GN=surE PE=3 SV=1 18 222 2.0E-06
sp|A3QC82|SURE_SHELP 5'-nucleotidase SurE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=surE PE=3 SV=1 19 214 2.0E-06
sp|A1WWY6|SURE_HALHL 5'-nucleotidase SurE OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=surE PE=3 SV=1 18 214 3.0E-06
sp|Q2GG44|SURE_EHRCR 5'-nucleotidase SurE OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=surE PE=3 SV=1 19 163 3.0E-06
sp|B0TAY4|SURE_HELMI 5'-nucleotidase SurE OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=surE PE=3 SV=1 97 214 3.0E-06
sp|Q899M5|SURE_CLOTE 5'-nucleotidase SurE OS=Clostridium tetani (strain Massachusetts / E88) GN=surE PE=3 SV=1 19 164 3.0E-06
sp|A5W821|SURE_PSEP1 5'-nucleotidase SurE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=surE PE=3 SV=1 18 214 3.0E-06
sp|A8FST3|SURE_SHESH 5'-nucleotidase SurE OS=Shewanella sediminis (strain HAW-EB3) GN=surE PE=3 SV=1 19 175 3.0E-06
sp|Q13Z72|SURE_BURXL 5'-nucleotidase SurE OS=Burkholderia xenovorans (strain LB400) GN=surE PE=3 SV=1 19 233 3.0E-06
sp|Q3SRQ5|SURE_NITWN 5'-nucleotidase SurE OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=surE PE=3 SV=1 18 214 3.0E-06
sp|Q3ADI0|SURE_CARHZ 5'-nucleotidase SurE OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=surE PE=3 SV=1 97 214 3.0E-06
sp|A7I2X3|SURE_CAMHC 5'-nucleotidase SurE OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=surE PE=3 SV=1 18 214 3.0E-06
sp|B1KPT1|SURE_SHEWM 5'-nucleotidase SurE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=surE PE=3 SV=1 19 204 4.0E-06
sp|Q0C0W3|SURE_HYPNA 5'-nucleotidase SurE OS=Hyphomonas neptunium (strain ATCC 15444) GN=surE PE=3 SV=1 18 214 4.0E-06
sp|O08248|SURE_RHIME 5'-nucleotidase SurE OS=Rhizobium meliloti (strain 1021) GN=surE PE=3 SV=2 120 214 4.0E-06
sp|Q1QU76|SURE_CHRSD 5'-nucleotidase SurE OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=surE PE=3 SV=1 19 214 4.0E-06
sp|Q3A4N5|SURE_PELCD 5'-nucleotidase SurE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=surE PE=3 SV=1 123 214 4.0E-06
sp|A2BSJ2|SURE_PROMS 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain AS9601) GN=surE PE=3 SV=1 18 233 4.0E-06
sp|A1BI19|SURE_CHLPD 5'-nucleotidase SurE OS=Chlorobium phaeobacteroides (strain DSM 266) GN=surE PE=3 SV=1 95 218 5.0E-06
sp|B8DN39|SURE_DESVM 5'-nucleotidase SurE OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=surE PE=3 SV=1 22 260 5.0E-06
sp|Q6FCV6|SURE_ACIAD 5'-nucleotidase SurE OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=surE PE=3 SV=1 97 214 6.0E-06
sp|A9BER9|SURE_PETMO 5'-nucleotidase SurE OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=surE PE=3 SV=1 18 165 7.0E-06
sp|Q57979|SURE_METJA 5'-nucleotidase SurE OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=surE PE=3 SV=2 123 215 7.0E-06
sp|Q88MF1|SURE_PSEPK 5'-nucleotidase SurE OS=Pseudomonas putida (strain KT2440) GN=surE PE=3 SV=1 18 214 8.0E-06
sp|B9KDQ8|SURE_CAMLR 5'-nucleotidase SurE OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=surE PE=3 SV=1 123 229 8.0E-06
sp|B5ZMG1|SURE_RHILW 5'-nucleotidase SurE OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=surE PE=3 SV=1 120 214 9.0E-06
sp|B3PXU4|SURE_RHIE6 5'-nucleotidase SurE OS=Rhizobium etli (strain CIAT 652) GN=surE PE=3 SV=1 120 214 9.0E-06
sp|Q1D402|SURE_MYXXD 5'-nucleotidase SurE OS=Myxococcus xanthus (strain DK 1622) GN=surE PE=3 SV=1 19 219 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1745
MLSTTLLLALASAAHSAHIIQSNDDGWAELYLRTLNSALVASSHQVLLSGPADNKSGSGSRDSNPQKRSKACQYA
SCGANSNAEWGVNQTTGTQFWVNSYPATSMRYAMDTFAPRVWGSDVKPDIAISGPNVGANLWVEVPFSGTVGAAC
YAVNRGLPAIAFSALSGPSAAWNTSPIPDRALLYADLAANLTNRILESGKPYLPPGVFLNVNFPRYKEPCTKAAN
FKWVLTRINPGPLSPPDTTTCGSSRLPTELEVALSNNCHISVSVGDASDKTTINDDRQKVVLDKLGDMLSCM*
Coding >OphauB2|1745
ATGCTTTCCACCACTCTTCTCCTCGCCCTCGCCTCCGCCGCCCACTCGGCCCACATCATCCAGTCCAACGACGAC
GGCTGGGCAGAGCTCTATCTCCGCACCCTAAACTCGGCCCTCGTCGCCTCTTCGCACCAGGTCCTCCTCTCCGGG
CCCGCAGACAACAAGTCTGGCTCCGGCTCCCGCGACTCCAATCCCCAGAAACGCTCCAAGGCTTGCCAGTATGCC
TCGTGCGGCGCAAATTCAAATGCGGAATGGGGCGTCAATCAGACAACCGGCACCCAGTTTTGGGTAAACTCGTAT
CCTGCAACCTCGATGCGCTACGCCATGGATACCTTTGCCCCAAGGGTTTGGGGGTCCGACGTGAAGCCAGACATT
GCCATTTCTGGGCCCAATGTTGGCGCCAATCTCTGGGTCGAGGTGCCCTTTTCGGGAACCGTTGGCGCGGCTTGC
TATGCTGTTAATCGGGGCTTGCCCGCCATTGCCTTTTCCGCCCTCTCAGGCCCAAGTGCCGCCTGGAACACGTCG
CCTATTCCCGACCGCGCCCTCCTCTACGCAGACTTGGCCGCCAACCTGACTAACCGCATCCTCGAGTCGGGAAAG
CCCTATTTGCCGCCGGGCGTCTTCTTGAATGTAAACTTTCCCAGATACAAGGAGCCCTGCACCAAGGCTGCCAAC
TTCAAATGGGTCCTTACTCGAATCAACCCGGGCCCCTTGTCGCCCCCGGATACAACCACTTGTGGCTCTTCAAGA
CTGCCTACCGAGCTCGAGGTGGCTCTCAGCAATAATTGCCACATCTCGGTTAGTGTTGGCGACGCCTCCGACAAG
ACCACCATCAACGACGACCGCCAAAAGGTTGTCTTGGACAAGCTTGGCGACATGCTCAGTTGCATGTAA
Transcript >OphauB2|1745
ATGCTTTCCACCACTCTTCTCCTCGCCCTCGCCTCCGCCGCCCACTCGGCCCACATCATCCAGTCCAACGACGAC
GGCTGGGCAGAGCTCTATCTCCGCACCCTAAACTCGGCCCTCGTCGCCTCTTCGCACCAGGTCCTCCTCTCCGGG
CCCGCAGACAACAAGTCTGGCTCCGGCTCCCGCGACTCCAATCCCCAGAAACGCTCCAAGGCTTGCCAGTATGCC
TCGTGCGGCGCAAATTCAAATGCGGAATGGGGCGTCAATCAGACAACCGGCACCCAGTTTTGGGTAAACTCGTAT
CCTGCAACCTCGATGCGCTACGCCATGGATACCTTTGCCCCAAGGGTTTGGGGGTCCGACGTGAAGCCAGACATT
GCCATTTCTGGGCCCAATGTTGGCGCCAATCTCTGGGTCGAGGTGCCCTTTTCGGGAACCGTTGGCGCGGCTTGC
TATGCTGTTAATCGGGGCTTGCCCGCCATTGCCTTTTCCGCCCTCTCAGGCCCAAGTGCCGCCTGGAACACGTCG
CCTATTCCCGACCGCGCCCTCCTCTACGCAGACTTGGCCGCCAACCTGACTAACCGCATCCTCGAGTCGGGAAAG
CCCTATTTGCCGCCGGGCGTCTTCTTGAATGTAAACTTTCCCAGATACAAGGAGCCCTGCACCAAGGCTGCCAAC
TTCAAATGGGTCCTTACTCGAATCAACCCGGGCCCCTTGTCGCCCCCGGATACAACCACTTGTGGCTCTTCAAGA
CTGCCTACCGAGCTCGAGGTGGCTCTCAGCAATAATTGCCACATCTCGGTTAGTGTTGGCGACGCCTCCGACAAG
ACCACCATCAACGACGACCGCCAAAAGGTTGTCTTGGACAAGCTTGGCGACATGCTCAGTTGCATGTAA
Gene >OphauB2|1745
ATGCTTTCCACCACTCTTCTCCTCGCCCTCGCCTCCGCCGCCCACTCGGCCCACATCATCCAGTCCAACGACGAC
GGCTGGGCAGAGCTCTATCTCCGCACCCTAAACTCGGCCCTCGTCGCCTCTTCGCACCAGGTCCTCCTCTCCGGG
CCCGCAGACAACAAGTCTGGCTCCGGCTCCCGCGACTCCAATCCCCAGAAACGCTCCAAGGCTTGCCAGTATGCC
TCGTGCGGCGCAAATTCAAATGCGGAATGGGGCGTCAATCAGACAACCGGCACCCAGTTTTGGGTAAACTCGTAT
CCTGCAACCTCGATGCGCTACGCCATGGATACCTTTGCCCCAAGGGTTTGGGGGTCCGACGTGAAGCCAGACATT
GCCATTTCTGGGCCCAATGTTGGCGCCAATCTCTGGGTCGAGGTGCCCTTTTCGGGAACCGTTGGCGCGGCTTGC
TATGCTGTTAATCGGGGCTTGCCCGCCATTGCCTTTTCCGCCCTCTCAGGCCCAAGTGCCGCCTGGAACACGTCG
CCTATTCCCGACCGCGCCCTCCTCTACGCAGACTTGGCCGCCAACCTGACTAACCGCATCCTCGAGTCGGGAAAG
CCCTATTTGCCGCCGGGCGTCTTCTTGAATGTAAACTTTCCCAGATACAAGGAGCCCTGCACCAAGGCTGCCAAC
TTCAAATGGGTCCTTACTCGAATCAACCCGGGCCCCTTGTCGCCCCCGGATACAACCACTTGTGGCTCTTCAAGA
CTGCCTACCGAGCTCGAGGTGGCTCTCAGCAATAATTGCCACATCTCGGTTAGTGTTGGCGACGCCTCCGACAAG
ACCACCATCAACGACGACCGCCAAAAGGTTGTCTTGGACAAGCTTGGCGACATGCTCAGTTGCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail