Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|174
Gene name
LocationContig_10:28494..30714
Strand-
Gene length (bp)2220
Transcript length (bp)2157
Coding sequence length (bp)2157
Protein length (aa) 719

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 1.7E-05 374 404
PF00400 WD40 WD domain, G-beta repeat 2.2E-03 532 567
PF00400 WD40 WD domain, G-beta repeat 2.1E-06 571 609
PF00400 WD40 WD domain, G-beta repeat 6.6E-04 613 651
PF12937 F-box-like F-box-like 1.8E-08 277 321
PF00646 F-box F-box domain 5.8E-05 278 316

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 273 693 4.0E-65
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 273 693 1.0E-64
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 273 693 1.0E-64
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 273 693 1.0E-60
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 273 693 1.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 273 693 4.0E-65
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 273 693 1.0E-64
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 273 693 1.0E-64
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 273 693 1.0E-60
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 273 693 1.0E-60
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 273 693 1.0E-55
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 273 717 2.0E-49
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 273 698 3.0E-49
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 273 717 6.0E-49
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 273 717 2.0E-48
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 273 717 5.0E-45
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 268 650 3.0E-40
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 260 656 2.0E-39
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 267 661 4.0E-37
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 268 695 4.0E-36
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 338 696 1.0E-34
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 268 580 6.0E-34
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 268 580 6.0E-34
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 268 656 7.0E-34
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 260 653 5.0E-33
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 273 695 9.0E-32
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 268 692 6.0E-31
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 458 696 7.0E-31
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 273 710 2.0E-30
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 374 696 3.0E-30
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 268 692 4.0E-29
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 391 683 6.0E-29
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 387 658 6.0E-29
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 374 683 2.0E-28
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 374 690 2.0E-28
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 472 693 3.0E-28
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 372 708 6.0E-28
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 391 683 7.0E-28
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 472 693 1.0E-27
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 391 683 2.0E-27
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 472 693 2.0E-27
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 350 656 3.0E-27
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 472 693 3.0E-27
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 472 693 4.0E-27
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 472 693 4.0E-27
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 472 693 4.0E-27
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 472 693 4.0E-27
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 472 693 4.0E-27
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 472 693 5.0E-27
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 364 655 8.0E-27
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 472 693 8.0E-27
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 472 693 8.0E-27
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 472 693 8.0E-27
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 472 693 9.0E-27
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 462 707 1.0E-26
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 351 677 1.0E-26
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 372 669 2.0E-26
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 472 693 2.0E-26
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 472 696 2.0E-26
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 344 677 5.0E-26
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 472 693 6.0E-26
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 459 693 8.0E-26
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 469 669 1.0E-25
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 260 631 1.0E-25
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 374 636 2.0E-25
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 472 693 2.0E-25
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 374 656 3.0E-25
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 469 654 3.0E-25
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 374 711 4.0E-25
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 368 693 4.0E-25
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 472 696 5.0E-25
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 472 693 6.0E-25
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 472 669 9.0E-25
sp|P87060|POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 269 661 2.0E-24
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 459 696 2.0E-24
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 459 696 2.0E-24
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 469 715 3.0E-24
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 375 669 4.0E-24
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 397 696 7.0E-24
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 459 629 1.0E-23
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 477 693 1.0E-23
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 445 685 1.0E-23
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 350 692 1.0E-23
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 459 629 2.0E-23
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 350 692 2.0E-23
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 472 693 2.0E-23
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 459 655 2.0E-23
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 353 677 2.0E-23
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 472 693 2.0E-23
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 514 655 3.0E-23
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 459 693 3.0E-23
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 422 693 3.0E-23
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 374 685 4.0E-23
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 485 707 5.0E-23
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 374 650 6.0E-23
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 472 693 6.0E-23
sp|P53699|CDC4_CANAX Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 268 704 6.0E-23
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 459 693 7.0E-23
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 459 693 7.0E-23
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 459 693 7.0E-23
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 372 676 7.0E-23
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 422 693 7.0E-23
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 472 693 7.0E-23
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 472 693 8.0E-23
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 472 693 8.0E-23
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 350 692 8.0E-23
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 350 692 8.0E-23
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 374 650 9.0E-23
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 350 692 9.0E-23
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 374 696 9.0E-23
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 374 654 1.0E-22
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 374 650 1.0E-22
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 429 696 1.0E-22
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 472 695 1.0E-22
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 469 693 1.0E-22
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 457 695 1.0E-22
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 497 656 2.0E-22
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 497 656 2.0E-22
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 365 654 2.0E-22
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 374 654 2.0E-22
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 365 654 2.0E-22
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 365 654 2.0E-22
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 365 654 2.0E-22
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 254 651 2.0E-22
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 472 693 2.0E-22
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 372 608 2.0E-22
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 472 693 2.0E-22
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 472 693 2.0E-22
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 448 654 3.0E-22
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 472 693 3.0E-22
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 450 693 3.0E-22
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 469 654 5.0E-22
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 372 654 5.0E-22
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 374 651 6.0E-22
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 459 688 9.0E-22
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 372 608 1.0E-21
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 370 655 1.0E-21
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 369 655 1.0E-21
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 369 655 1.0E-21
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 459 661 1.0E-21
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 451 696 2.0E-21
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 457 688 2.0E-21
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 374 653 2.0E-21
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 370 655 2.0E-21
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 490 661 3.0E-21
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 459 661 3.0E-21
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 458 673 4.0E-21
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 372 651 5.0E-21
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 459 655 5.0E-21
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 374 650 6.0E-21
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 473 696 8.0E-21
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 469 654 8.0E-21
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 461 658 8.0E-21
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 483 654 1.0E-20
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 469 672 1.0E-20
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 537 696 1.0E-20
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 514 652 1.0E-20
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 453 692 2.0E-20
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 374 651 2.0E-20
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 359 688 2.0E-20
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 472 653 2.0E-20
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 497 696 3.0E-20
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 459 659 3.0E-20
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 514 707 3.0E-20
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 374 651 4.0E-20
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 374 651 4.0E-20
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 454 661 4.0E-20
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 497 660 4.0E-20
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 374 693 4.0E-20
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 471 661 4.0E-20
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 454 661 5.0E-20
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 454 661 5.0E-20
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 454 661 5.0E-20
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 454 661 5.0E-20
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 374 652 5.0E-20
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 461 653 5.0E-20
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 459 693 5.0E-20
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 411 658 6.0E-20
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 350 692 7.0E-20
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 461 653 7.0E-20
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 457 669 8.0E-20
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 472 653 8.0E-20
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 374 693 8.0E-20
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 374 652 8.0E-20
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 454 661 9.0E-20
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 387 659 9.0E-20
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 472 653 9.0E-20
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 372 652 1.0E-19
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 471 661 1.0E-19
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 370 652 1.0E-19
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 469 656 1.0E-19
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 369 693 1.0E-19
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 488 658 2.0E-19
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 374 651 2.0E-19
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 488 658 2.0E-19
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 374 651 2.0E-19
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 537 707 2.0E-19
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 490 696 2.0E-19
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 537 707 2.0E-19
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 537 707 2.0E-19
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 537 707 2.0E-19
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 533 707 2.0E-19
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 472 695 2.0E-19
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 457 669 2.0E-19
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 469 672 2.0E-19
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 494 653 2.0E-19
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 472 652 2.0E-19
sp|A8PTE4|MDV1_MALGO Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 374 608 2.0E-19
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 374 690 2.0E-19
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 374 651 3.0E-19
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 490 657 3.0E-19
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 497 656 3.0E-19
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 497 656 3.0E-19
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 374 654 3.0E-19
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 369 693 3.0E-19
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 473 651 3.0E-19
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 473 651 3.0E-19
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 374 658 4.0E-19
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 374 651 4.0E-19
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 374 651 4.0E-19
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 374 651 4.0E-19
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 374 651 4.0E-19
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 374 651 4.0E-19
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 374 651 4.0E-19
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 472 693 4.0E-19
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 374 654 4.0E-19
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 491 658 4.0E-19
sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 375 683 4.0E-19
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 473 675 5.0E-19
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 469 672 5.0E-19
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 488 658 5.0E-19
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 374 652 5.0E-19
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 368 611 5.0E-19
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 372 652 6.0E-19
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 372 652 6.0E-19
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 369 693 6.0E-19
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 498 658 6.0E-19
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 487 658 7.0E-19
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 488 658 7.0E-19
sp|Q4P8R5|MDV1_USTMA Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 374 608 7.0E-19
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 373 658 7.0E-19
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 374 651 8.0E-19
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 391 650 8.0E-19
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 391 650 8.0E-19
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 372 652 8.0E-19
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 374 650 9.0E-19
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 374 651 1.0E-18
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 472 626 1.0E-18
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 372 651 1.0E-18
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 497 658 1.0E-18
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 493 656 1.0E-18
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 374 652 1.0E-18
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 493 656 1.0E-18
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 374 652 1.0E-18
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 457 651 1.0E-18
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 374 651 2.0E-18
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 368 694 2.0E-18
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 374 651 2.0E-18
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 372 652 2.0E-18
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 374 690 2.0E-18
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 372 652 2.0E-18
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 372 652 2.0E-18
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 457 651 2.0E-18
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 374 652 2.0E-18
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 374 654 2.0E-18
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 374 651 3.0E-18
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 459 652 3.0E-18
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 372 652 3.0E-18
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 445 696 3.0E-18
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 497 658 4.0E-18
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 472 696 4.0E-18
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 488 658 5.0E-18
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 374 652 5.0E-18
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 485 661 5.0E-18
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 497 656 5.0E-18
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 457 693 5.0E-18
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 331 656 5.0E-18
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 458 652 5.0E-18
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 537 707 6.0E-18
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 473 696 6.0E-18
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 370 653 6.0E-18
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 374 650 7.0E-18
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 372 652 7.0E-18
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 374 652 7.0E-18
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 457 693 7.0E-18
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 457 693 7.0E-18
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 450 651 7.0E-18
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 497 656 7.0E-18
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 450 651 7.0E-18
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 457 693 7.0E-18
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 459 653 8.0E-18
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 374 652 8.0E-18
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 450 669 8.0E-18
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 459 696 8.0E-18
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 457 671 9.0E-18
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 369 650 9.0E-18
sp|Q6CB13|MDV1_YARLI Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 359 651 9.0E-18
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 472 696 9.0E-18
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 535 707 1.0E-17
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 374 651 1.0E-17
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 469 690 1.0E-17
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 368 650 1.0E-17
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 452 712 1.0E-17
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 457 651 1.0E-17
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 374 652 1.0E-17
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 374 690 1.0E-17
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 469 653 1.0E-17
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 368 617 1.0E-17
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 384 656 2.0E-17
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 356 659 2.0E-17
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 451 693 2.0E-17
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 368 611 2.0E-17
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 373 650 2.0E-17
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 485 661 2.0E-17
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 372 673 2.0E-17
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 372 673 2.0E-17
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 497 712 2.0E-17
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 459 654 2.0E-17
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 497 656 2.0E-17
sp|Q0U2T3|MDV1_PHANO Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 350 655 2.0E-17
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 373 658 2.0E-17
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 374 690 2.0E-17
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 373 680 3.0E-17
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 497 712 3.0E-17
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 372 652 3.0E-17
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 372 652 3.0E-17
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 368 650 3.0E-17
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 374 690 3.0E-17
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 457 694 3.0E-17
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 485 654 4.0E-17
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 497 654 4.0E-17
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 459 654 4.0E-17
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 452 658 4.0E-17
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 459 696 4.0E-17
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 459 696 4.0E-17
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 473 696 4.0E-17
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 374 690 4.0E-17
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 375 661 4.0E-17
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 514 712 4.0E-17
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 537 708 5.0E-17
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 459 652 5.0E-17
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 451 696 5.0E-17
sp|Q5SUS0|FBW10_MOUSE F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 466 696 5.0E-17
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 497 712 5.0E-17
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 374 653 6.0E-17
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 359 685 6.0E-17
sp|Q4P8R5|MDV1_USTMA Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 374 690 6.0E-17
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 495 693 6.0E-17
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 457 651 6.0E-17
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 457 704 6.0E-17
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 490 655 6.0E-17
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 497 712 6.0E-17
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 491 652 7.0E-17
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 491 652 7.0E-17
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 374 651 8.0E-17
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 505 652 8.0E-17
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 513 654 8.0E-17
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 497 661 9.0E-17
sp|P79147|GBB3_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 374 651 9.0E-17
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 534 693 1.0E-16
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 374 651 1.0E-16
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 391 651 1.0E-16
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 374 653 1.0E-16
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 374 650 1.0E-16
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 373 658 1.0E-16
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 374 652 1.0E-16
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 368 611 1.0E-16
sp|A2QP30|LIS1_ASPNC Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 374 669 1.0E-16
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 491 658 1.0E-16
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 494 661 1.0E-16
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 497 652 1.0E-16
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 369 650 1.0E-16
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 497 712 1.0E-16
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 372 651 2.0E-16
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 372 651 2.0E-16
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 372 651 2.0E-16
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 459 696 2.0E-16
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 373 650 2.0E-16
sp|A4RJV3|MDV1_MAGO7 Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 374 705 2.0E-16
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 514 712 2.0E-16
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 514 712 2.0E-16
sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 374 651 2.0E-16
sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 374 651 2.0E-16
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 497 652 2.0E-16
sp|P0CS44|MDV1_CRYNJ Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 374 608 2.0E-16
sp|P0CS45|MDV1_CRYNB Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 374 608 2.0E-16
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 374 651 3.0E-16
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 374 650 3.0E-16
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 451 688 3.0E-16
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 375 652 3.0E-16
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 387 659 3.0E-16
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 374 651 3.0E-16
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 470 650 3.0E-16
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 374 650 3.0E-16
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 491 658 4.0E-16
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 496 658 4.0E-16
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 505 658 4.0E-16
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 441 661 4.0E-16
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 374 650 4.0E-16
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 369 650 4.0E-16
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 374 650 4.0E-16
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 429 661 5.0E-16
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 472 652 5.0E-16
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 472 652 5.0E-16
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 497 712 5.0E-16
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 442 660 5.0E-16
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 442 660 5.0E-16
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 442 660 5.0E-16
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 442 660 5.0E-16
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 442 660 5.0E-16
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 442 660 5.0E-16
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 442 660 5.0E-16
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 457 669 5.0E-16
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 537 702 6.0E-16
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 459 655 6.0E-16
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 497 696 6.0E-16
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 374 650 6.0E-16
sp|Q6CB13|MDV1_YARLI Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 459 695 7.0E-16
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 494 709 7.0E-16
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 459 655 8.0E-16
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 525 708 8.0E-16
sp|Q758R7|MDV1_ASHGO Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 372 567 8.0E-16
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 473 651 9.0E-16
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 372 650 9.0E-16
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 447 661 9.0E-16
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 375 621 9.0E-16
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 374 651 9.0E-16
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 374 651 9.0E-16
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 374 651 9.0E-16
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 374 651 9.0E-16
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 494 709 9.0E-16
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 446 633 9.0E-16
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 537 693 1.0E-15
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 537 693 1.0E-15
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 536 696 1.0E-15
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 491 676 1.0E-15
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 473 651 1.0E-15
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 473 696 1.0E-15
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 372 652 1.0E-15
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 387 658 1.0E-15
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 493 652 1.0E-15
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 473 669 1.0E-15
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 374 651 1.0E-15
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 442 663 1.0E-15
sp|O95170|CDRT1_HUMAN CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 497 696 1.0E-15
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 497 696 1.0E-15
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 497 696 1.0E-15
sp|Q5XX13|FBW10_HUMAN F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2 497 696 1.0E-15
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 374 650 1.0E-15
sp|Q0CJD8|MDV1_ASPTN Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 374 656 1.0E-15
sp|P87060|POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 432 696 2.0E-15
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 537 693 2.0E-15
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 374 651 2.0E-15
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 494 693 2.0E-15
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 374 650 2.0E-15
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 471 702 2.0E-15
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 497 712 2.0E-15
sp|Q68FJ6|PK1IP_XENLA p21-activated protein kinase-interacting protein 1-like OS=Xenopus laevis GN=pak1ip1 PE=2 SV=1 455 653 2.0E-15
sp|Q5AXW3|MDV1_EMENI Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 451 696 2.0E-15
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 459 621 2.0E-15
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 459 621 2.0E-15
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 459 621 2.0E-15
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 459 621 2.0E-15
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 490 669 3.0E-15
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 537 708 3.0E-15
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 370 650 3.0E-15
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 368 626 3.0E-15
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 497 657 3.0E-15
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 459 621 3.0E-15
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 459 621 3.0E-15
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 353 650 3.0E-15
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 497 712 3.0E-15
sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 374 651 3.0E-15
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 374 692 3.0E-15
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 459 621 3.0E-15
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 391 669 3.0E-15
sp|Q6CJ50|MDV1_KLULA Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 372 571 3.0E-15
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 473 683 4.0E-15
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 537 708 4.0E-15
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 537 708 4.0E-15
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 370 650 4.0E-15
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 533 692 4.0E-15
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 489 655 4.0E-15
sp|Q0CJD8|MDV1_ASPTN Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 374 696 4.0E-15
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 326 650 4.0E-15
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 355 651 4.0E-15
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 497 657 4.0E-15
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 537 708 5.0E-15
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 537 708 5.0E-15
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 537 708 5.0E-15
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 537 708 5.0E-15
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 537 708 5.0E-15
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 537 708 5.0E-15
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 537 708 5.0E-15
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 537 708 5.0E-15
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 437 653 5.0E-15
sp|A4RJV3|MDV1_MAGO7 Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 372 608 5.0E-15
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 459 661 5.0E-15
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 473 659 5.0E-15
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 473 659 5.0E-15
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 495 661 5.0E-15
sp|A7ETB3|MDV1_SCLS1 Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 374 655 5.0E-15
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 374 651 5.0E-15
sp|A1DDL6|MDV1_NEOFI Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 374 696 5.0E-15
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 459 621 5.0E-15
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 522 696 6.0E-15
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 387 650 6.0E-15
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 495 661 6.0E-15
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 494 661 6.0E-15
sp|Q8C7V3|UTP15_MOUSE U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 469 650 6.0E-15
sp|Q54SF9|MHCKD_DICDI Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 464 705 6.0E-15
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 429 650 6.0E-15
sp|A1CBP8|MDV1_ASPCL Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 374 692 6.0E-15
sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 374 651 6.0E-15
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 537 708 7.0E-15
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 354 654 7.0E-15
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 354 654 7.0E-15
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 459 651 7.0E-15
sp|A8PTE4|MDV1_MALGO Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 374 647 7.0E-15
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 353 650 7.0E-15
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 374 659 7.0E-15
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 374 667 7.0E-15
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 537 708 8.0E-15
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 537 708 8.0E-15
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 493 656 8.0E-15
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 473 659 8.0E-15
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 359 662 8.0E-15
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 374 667 8.0E-15
sp|A2R3Z3|MDV1_ASPNC Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 374 696 8.0E-15
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 457 693 9.0E-15
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 537 708 1.0E-14
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 390 625 1.0E-14
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 494 661 1.0E-14
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 497 696 1.0E-14
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 493 655 1.0E-14
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 533 693 1.0E-14
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 372 652 1.0E-14
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 533 692 1.0E-14
sp|P49177|GBB_ARATH Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1 374 650 1.0E-14
sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 374 650 1.0E-14
sp|Q6PFM9|WDR48_DANRE WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 457 693 1.0E-14
sp|Q20636|GBB2_CAEEL Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 353 651 1.0E-14
sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 374 651 1.0E-14
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 429 653 1.0E-14
sp|Q9NWT1|PK1IP_HUMAN p21-activated protein kinase-interacting protein 1 OS=Homo sapiens GN=PAK1IP1 PE=1 SV=2 452 658 1.0E-14
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 537 708 2.0E-14
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 537 690 2.0E-14
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 374 612 2.0E-14
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 372 611 2.0E-14
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 494 662 2.0E-14
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 494 662 2.0E-14
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 469 658 2.0E-14
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 374 690 2.0E-14
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 368 652 2.0E-14
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 493 655 2.0E-14
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 533 692 2.0E-14
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 533 693 2.0E-14
sp|A2QP30|LIS1_ASPNC Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 488 658 2.0E-14
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 510 712 2.0E-14
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 450 696 2.0E-14
sp|Q1DIW7|MDV1_COCIM Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 374 701 2.0E-14
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 376 650 2.0E-14
sp|Q2U5Z8|MDV1_ASPOR Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 374 696 2.0E-14
sp|Q9DCE5|PK1IP_MOUSE p21-activated protein kinase-interacting protein 1 OS=Mus musculus GN=Pak1ip1 PE=1 SV=2 452 652 2.0E-14
sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 374 651 2.0E-14
sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 374 651 2.0E-14
sp|P62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 374 651 2.0E-14
sp|P62872|GBB1_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 374 651 2.0E-14
sp|P62871|GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 374 651 2.0E-14
sp|P49027|GBLPA_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 391 661 2.0E-14
sp|Q58D00|FBXW2_BOVIN F-box/WD repeat-containing protein 2 OS=Bos taurus GN=FBXW2 PE=2 SV=1 259 620 2.0E-14
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 510 661 2.0E-14
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 497 657 2.0E-14
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 459 654 3.0E-14
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 466 653 3.0E-14
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 533 707 3.0E-14
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 520 657 3.0E-14
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 362 659 3.0E-14
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 374 652 3.0E-14
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 497 693 3.0E-14
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 510 654 3.0E-14
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 510 654 3.0E-14
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 510 654 3.0E-14
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 510 654 3.0E-14
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 510 654 3.0E-14
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 510 654 3.0E-14
sp|Q58D00|FBXW2_BOVIN F-box/WD repeat-containing protein 2 OS=Bos taurus GN=FBXW2 PE=2 SV=1 459 694 3.0E-14
sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 374 651 3.0E-14
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 469 700 3.0E-14
sp|Q9UKT8|FBXW2_HUMAN F-box/WD repeat-containing protein 2 OS=Homo sapiens GN=FBXW2 PE=1 SV=2 459 694 3.0E-14
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 374 667 3.0E-14
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 537 689 4.0E-14
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 466 653 4.0E-14
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 533 692 4.0E-14
sp|Q9UKT8|FBXW2_HUMAN F-box/WD repeat-containing protein 2 OS=Homo sapiens GN=FBXW2 PE=1 SV=2 259 620 4.0E-14
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 364 659 4.0E-14
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 459 651 4.0E-14
sp|B2RZ17|FBXW2_RAT F-box/WD repeat-containing protein 2 OS=Rattus norvegicus GN=Fbxw2 PE=2 SV=1 459 694 4.0E-14
sp|Q60584|FBXW2_MOUSE F-box/WD repeat-containing protein 2 OS=Mus musculus GN=Fbxw2 PE=2 SV=2 259 620 4.0E-14
sp|Q60584|FBXW2_MOUSE F-box/WD repeat-containing protein 2 OS=Mus musculus GN=Fbxw2 PE=2 SV=2 459 694 4.0E-14
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 471 692 4.0E-14
sp|Q4R2Z6|WDR48_MACFA WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 457 693 4.0E-14
sp|Q9H2Y7|ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens GN=ZNF106 PE=1 SV=1 305 649 4.0E-14
sp|Q5F3K4|WDR48_CHICK WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 457 693 4.0E-14
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 514 658 4.0E-14
sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 374 651 4.0E-14
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 482 692 4.0E-14
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 494 661 5.0E-14
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 359 658 5.0E-14
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 369 633 5.0E-14
sp|Q54SF9|MHCKD_DICDI Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 376 651 5.0E-14
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 537 715 5.0E-14
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 510 654 5.0E-14
sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 459 653 5.0E-14
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 374 667 5.0E-14
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 537 689 6.0E-14
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 375 654 6.0E-14
sp|Q5AXW3|MDV1_EMENI Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 373 656 6.0E-14
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 376 658 6.0E-14
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 459 696 6.0E-14
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 514 658 6.0E-14
sp|Q32PG3|WDR48_BOVIN WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 457 693 6.0E-14
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 491 658 6.0E-14
sp|Q2H139|MDV1_CHAGB Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 374 692 6.0E-14
sp|Q8TAF3|WDR48_HUMAN WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 457 693 6.0E-14
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 351 567 6.0E-14
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 377 652 6.0E-14
sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 465 654 6.0E-14
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 464 655 7.0E-14
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 368 638 7.0E-14
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 510 654 7.0E-14
sp|B2RZ17|FBXW2_RAT F-box/WD repeat-containing protein 2 OS=Rattus norvegicus GN=Fbxw2 PE=2 SV=1 259 620 7.0E-14
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 377 652 7.0E-14
sp|Q54N86|FBXAL_DICDI F-box/WD repeat-containing protein A-like protein OS=Dictyostelium discoideum GN=DDB_G0285445 PE=3 SV=1 350 657 7.0E-14
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 496 696 7.0E-14
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 470 697 7.0E-14
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 493 658 7.0E-14
sp|Q6TMK6|GBB1_CRIGR Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 374 651 7.0E-14
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 473 697 7.0E-14
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 387 650 8.0E-14
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 450 696 8.0E-14
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 335 651 8.0E-14
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 335 651 8.0E-14
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 510 654 8.0E-14
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 457 669 8.0E-14
sp|Q5RAW8|WDR48_PONAB WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 457 693 8.0E-14
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 374 651 8.0E-14
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 469 653 8.0E-14
sp|Q5R5W8|GBB1_PONAB Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 374 651 8.0E-14
sp|Q0U2T3|MDV1_PHANO Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 374 709 9.0E-14
sp|P49027|GBLPA_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 514 712 9.0E-14
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 374 653 1.0E-13
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 368 652 1.0E-13
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 374 629 1.0E-13
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 374 615 1.0E-13
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 533 692 1.0E-13
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 376 661 1.0E-13
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 376 661 1.0E-13
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 459 706 1.0E-13
sp|Q6CJ50|MDV1_KLULA Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 448 696 1.0E-13
sp|A1DDL6|MDV1_NEOFI Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 373 656 1.0E-13
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 430 619 1.0E-13
sp|Q4WVS4|MDV1_ASPFU Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 373 656 1.0E-13
sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 374 651 1.0E-13
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 374 567 1.0E-13
sp|Q6DH44|WDR83_DANRE WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 469 662 1.0E-13
sp|Q8BH57|WDR48_MOUSE WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 457 693 1.0E-13
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 374 616 2.0E-13
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 374 629 2.0E-13
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 374 663 2.0E-13
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 459 655 2.0E-13
sp|Q5SUS0|FBW10_MOUSE F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 273 658 2.0E-13
sp|Q2U5Z8|MDV1_ASPOR Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 373 656 2.0E-13
sp|O88466|ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus GN=Znf106 PE=1 SV=3 374 649 2.0E-13
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 377 650 2.0E-13
sp|Q6TNS2|PK1IP_DANRE p21-activated protein kinase-interacting protein 1-like OS=Danio rerio GN=pak1ip1 PE=2 SV=1 454 652 2.0E-13
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 523 652 2.0E-13
sp|Q8TED0|UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 469 650 2.0E-13
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 422 661 2.0E-13
sp|A7MB12|UTP15_BOVIN U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 469 650 2.0E-13
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 374 612 3.0E-13
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 472 663 3.0E-13
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 472 663 3.0E-13
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 473 615 3.0E-13
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 459 671 3.0E-13
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 459 671 3.0E-13
sp|Q9AV81|PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 459 647 3.0E-13
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 473 704 3.0E-13
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 459 652 3.0E-13
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 537 673 4.0E-13
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 450 653 4.0E-13
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 374 692 4.0E-13
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 387 650 4.0E-13
sp|Q6CB13|MDV1_YARLI Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 491 696 4.0E-13
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 470 644 4.0E-13
sp|Q0U2T3|MDV1_PHANO Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 372 573 4.0E-13
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 495 652 4.0E-13
sp|A2R3Z3|MDV1_ASPNC Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 373 650 4.0E-13
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 448 659 4.0E-13
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 377 659 4.0E-13
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 459 650 4.0E-13
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 459 710 4.0E-13
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 377 659 4.0E-13
sp|Q5EA99|PK1IP_BOVIN p21-activated protein kinase-interacting protein 1 OS=Bos taurus GN=PAK1IP1 PE=2 SV=1 452 658 4.0E-13
sp|O94967|WDR47_HUMAN WD repeat-containing protein 47 OS=Homo sapiens GN=WDR47 PE=1 SV=1 445 653 4.0E-13
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 497 712 4.0E-13
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 377 652 4.0E-13
sp|Q5BLX8|WDR83_RAT WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 466 662 4.0E-13
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 374 611 5.0E-13
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 510 711 5.0E-13
sp|Q6Q0C0|TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 464 658 5.0E-13
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 459 650 5.0E-13
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 377 652 5.0E-13
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 452 625 5.0E-13
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 371 658 5.0E-13
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 359 658 6.0E-13
sp|Q2H139|MDV1_CHAGB Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 372 573 6.0E-13
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 377 652 6.0E-13
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 520 696 7.0E-13
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 372 651 7.0E-13
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 459 696 7.0E-13
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 497 712 7.0E-13
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 469 662 7.0E-13
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 510 661 7.0E-13
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 464 661 7.0E-13
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 377 659 7.0E-13
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 514 661 8.0E-13
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 374 650 8.0E-13
sp|Q54SF9|MHCKD_DICDI Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 459 690 8.0E-13
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 459 650 8.0E-13
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 495 661 9.0E-13
sp|A7THX0|MDV1_VANPO Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 376 655 9.0E-13
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 459 650 9.0E-13
sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 352 656 9.0E-13
sp|O35353|GBB4_RAT Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 374 651 9.0E-13
sp|C4YPI7|LIS1_CANAW Nuclear distribution protein PAC1 OS=Candida albicans (strain WO-1) GN=PAC1 PE=3 SV=1 472 645 9.0E-13
sp|Q5A7Q6|LIS1_CANAL Nuclear distribution protein PAC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAC1 PE=3 SV=1 472 645 9.0E-13
sp|P87060|POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 499 705 1.0E-12
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 494 661 1.0E-12
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 537 693 1.0E-12
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 383 654 1.0E-12
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 374 652 1.0E-12
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 372 652 1.0E-12
sp|Q6CJ50|MDV1_KLULA Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 360 675 1.0E-12
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 431 621 1.0E-12
sp|B9WD30|LIS1_CANDC Nuclear distribution protein PAC1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PAC1 PE=3 SV=1 472 629 1.0E-12
sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 464 658 1.0E-12
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 377 652 1.0E-12
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 377 652 1.0E-12
sp|O94620|CWF17_SCHPO Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 459 653 1.0E-12
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 383 650 1.0E-12
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 523 652 1.0E-12
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 377 659 1.0E-12
sp|Q9DAJ4|WDR83_MOUSE WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 466 662 1.0E-12
sp|Q5ZKU8|PK1IP_CHICK p21-activated protein kinase-interacting protein 1-like OS=Gallus gallus GN=PAK1IP1 PE=2 SV=1 455 662 1.0E-12
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 497 661 2.0E-12
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 374 611 2.0E-12
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 374 611 2.0E-12
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 374 611 2.0E-12
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 374 611 2.0E-12
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 500 661 2.0E-12
sp|A4RJV3|MDV1_MAGO7 Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 374 650 2.0E-12
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 469 673 2.0E-12
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 497 712 2.0E-12
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 497 712 2.0E-12
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 497 712 2.0E-12
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 497 712 2.0E-12
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 497 712 2.0E-12
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 497 712 2.0E-12
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 497 712 2.0E-12
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 391 651 2.0E-12
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 533 696 2.0E-12
sp|A7THX0|MDV1_VANPO Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 374 608 2.0E-12
sp|P27133|COROA_DICDI Coronin-A OS=Dictyostelium discoideum GN=corA PE=1 SV=2 500 651 2.0E-12
sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 374 651 2.0E-12
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 523 652 2.0E-12
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 523 652 2.0E-12
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 510 658 2.0E-12
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 523 652 2.0E-12
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 422 661 2.0E-12
sp|Q9BRX9|WDR83_HUMAN WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 466 662 2.0E-12
sp|Q6DJD8|COR2B_XENLA Coronin-2B OS=Xenopus laevis GN=coro2b PE=2 SV=1 500 653 2.0E-12
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 374 661 2.0E-12
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 420 708 2.0E-12
sp|Q06440|CORO_YEAST Coronin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRN1 PE=1 SV=1 476 651 2.0E-12
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 522 652 2.0E-12
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 495 655 2.0E-12
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 510 661 2.0E-12
sp|Q6NNP0|ATG16_ARATH Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 464 654 2.0E-12
sp|Q8CGF6|WDR47_MOUSE WD repeat-containing protein 47 OS=Mus musculus GN=Wdr47 PE=1 SV=2 445 653 2.0E-12
sp|Q9UQ03|COR2B_HUMAN Coronin-2B OS=Homo sapiens GN=CORO2B PE=1 SV=4 500 653 2.0E-12
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 459 696 3.0E-12
sp|P0CS44|MDV1_CRYNJ Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 497 659 3.0E-12
sp|P0CS45|MDV1_CRYNB Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 497 659 3.0E-12
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 533 693 3.0E-12
sp|Q1DIW7|MDV1_COCIM Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 373 650 3.0E-12
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 453 620 3.0E-12
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 471 672 3.0E-12
sp|C5MJE8|LIS1_CANTT Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 472 629 3.0E-12
sp|Q9C1X0|YN55_SCHPO Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.05 PE=3 SV=1 543 651 3.0E-12
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 523 661 3.0E-12
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 448 661 3.0E-12
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 448 661 3.0E-12
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 514 652 3.0E-12
sp|Q8BH44|COR2B_MOUSE Coronin-2B OS=Mus musculus GN=Coro2b PE=1 SV=2 500 653 3.0E-12
sp|Q54S59|WDR61_DICDI WD repeat-containing protein 61 homolog OS=Dictyostelium discoideum GN=wdr61 PE=3 SV=1 459 693 3.0E-12
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 537 693 3.0E-12
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 374 692 4.0E-12
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 372 644 4.0E-12
sp|A7ETB3|MDV1_SCLS1 Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 372 573 4.0E-12
sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 510 693 4.0E-12
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 459 702 4.0E-12
sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 374 650 4.0E-12
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 422 661 4.0E-12
sp|C4R6H3|LIS1_PICPG Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 472 692 4.0E-12
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 537 693 4.0E-12
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 473 650 4.0E-12
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 387 653 4.0E-12
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 469 718 4.0E-12
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 464 661 5.0E-12
sp|Q5BLX8|WDR83_RAT WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 534 654 5.0E-12
sp|Q6NNP0|ATG16_ARATH Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 464 656 5.0E-12
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 537 693 5.0E-12
sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 459 653 5.0E-12
sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 459 653 5.0E-12
sp|A6ZZZ8|CAF4_YEAS7 CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 374 652 5.0E-12
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 537 693 5.0E-12
sp|Q2H139|MDV1_CHAGB Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 374 650 6.0E-12
sp|Q758R7|MDV1_ASHGO Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 459 692 7.0E-12
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 372 608 7.0E-12
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 533 696 7.0E-12
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 514 652 7.0E-12
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 374 653 8.0E-12
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 459 662 8.0E-12
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 510 696 8.0E-12
sp|Q9DAJ4|WDR83_MOUSE WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 534 654 8.0E-12
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 522 652 8.0E-12
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 449 653 8.0E-12
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 415 650 9.0E-12
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 465 658 9.0E-12
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 377 650 9.0E-12
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 377 650 9.0E-12
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 473 654 9.0E-12
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 573 693 1.0E-11
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 473 671 1.0E-11
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 341 650 1.0E-11
sp|A2R3Z3|MDV1_ASPNC Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 372 567 1.0E-11
sp|Q1DIW7|MDV1_COCIM Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 372 608 1.0E-11
sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 377 569 1.0E-11
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 533 696 1.0E-11
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 464 659 1.0E-11
sp|Q9P7I3|MDV1_SCHPO Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 473 692 1.0E-11
sp|Q3KQ62|WDR83_XENLA WD repeat domain-containing protein 83 OS=Xenopus laevis GN=wdr83 PE=2 SV=1 496 696 1.0E-11
sp|Q3KQ62|WDR83_XENLA WD repeat domain-containing protein 83 OS=Xenopus laevis GN=wdr83 PE=2 SV=1 469 662 1.0E-11
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 376 608 1.0E-11
sp|Q2T9T9|FBXW9_BOVIN F-box/WD repeat-containing protein 9 OS=Bos taurus GN=FBXW9 PE=2 SV=1 363 538 1.0E-11
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 494 652 1.0E-11
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 376 651 1.0E-11
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 577 693 2.0E-11
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 577 693 2.0E-11
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 374 611 2.0E-11
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 391 658 2.0E-11
sp|A1CBP8|MDV1_ASPCL Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 372 567 2.0E-11
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 359 653 2.0E-11
sp|Q6DH44|WDR83_DANRE WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 532 651 2.0E-11
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 495 658 2.0E-11
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 537 688 2.0E-11
sp|Q9BRX9|WDR83_HUMAN WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 534 654 2.0E-11
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 451 650 2.0E-11
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 368 662 2.0E-11
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 349 652 2.0E-11
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 510 692 2.0E-11
sp|Q75AV4|PFS2_ASHGO Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 423 652 2.0E-11
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 497 712 2.0E-11
sp|Q6GMD2|WDR61_XENLA WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 471 672 2.0E-11
sp|Q5REE0|UTP15_PONAB U3 small nucleolar RNA-associated protein 15 homolog OS=Pongo abelii GN=UTP15 PE=2 SV=1 429 650 2.0E-11
sp|P93563|GBB_SOLTU Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1 374 650 2.0E-11
sp|P36037|DOA1_YEAST Protein DOA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA1 PE=1 SV=1 464 662 2.0E-11
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 504 696 3.0E-11
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 368 611 3.0E-11
sp|Q758R7|MDV1_ASHGO Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 374 650 3.0E-11
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 459 661 3.0E-11
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 459 661 3.0E-11
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 459 661 3.0E-11
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 459 661 3.0E-11
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 528 694 3.0E-11
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 428 653 3.0E-11
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 451 660 3.0E-11
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 368 662 3.0E-11
sp|Q0DYP5|C3H17_ORYSJ Zinc finger CCCH domain-containing protein 17 OS=Oryza sativa subsp. japonica GN=Os02g0677700 PE=2 SV=2 390 650 3.0E-11
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 510 658 3.0E-11
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 464 661 3.0E-11
sp|Q9DC48|PRP17_MOUSE Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1 539 698 3.0E-11
sp|O60508|PRP17_HUMAN Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1 539 698 3.0E-11
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 374 650 4.0E-11
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 372 569 4.0E-11
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 464 665 4.0E-11
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 374 650 5.0E-11
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 530 702 5.0E-11
sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 383 650 5.0E-11
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 374 653 5.0E-11
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 499 652 5.0E-11
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 459 662 5.0E-11
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 455 618 5.0E-11
sp|O74184|WAT1_SCHPO WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 374 591 5.0E-11
sp|Q6NX08|WDR12_DANRE Ribosome biogenesis protein wdr12 OS=Danio rerio GN=wdr12 PE=2 SV=1 377 697 5.0E-11
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 471 672 5.0E-11
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 494 655 5.0E-11
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 494 652 5.0E-11
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 464 659 5.0E-11
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 374 650 6.0E-11
sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 459 658 6.0E-11
sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 459 658 6.0E-11
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 375 609 6.0E-11
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 471 672 6.0E-11
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 376 652 6.0E-11
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 391 650 7.0E-11
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 374 654 7.0E-11
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 364 569 7.0E-11
sp|A8WGE3|COR2B_XENTR Coronin-2B OS=Xenopus tropicalis GN=coro2b PE=2 SV=1 500 653 7.0E-11
sp|Q5F3D7|UTP15_CHICK U3 small nucleolar RNA-associated protein 15 homolog OS=Gallus gallus GN=UTP15 PE=2 SV=1 460 650 7.0E-11
sp|Q32LN7|WDR61_BOVIN WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 471 672 7.0E-11
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 374 579 8.0E-11
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 469 658 8.0E-11
sp|Q5F3K4|WDR48_CHICK WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 447 652 8.0E-11
sp|Q6NNP0|ATG16_ARATH Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 509 685 8.0E-11
sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 494 652 8.0E-11
sp|Q9GZS3|WDR61_HUMAN WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 471 672 8.0E-11
sp|E3LB80|EIF3I_PUCGT Eukaryotic translation initiation factor 3 subunit I OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=TIF34 PE=3 SV=2 375 612 8.0E-11
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 579 695 9.0E-11
sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 459 658 9.0E-11
sp|Q4R2Z6|WDR48_MACFA WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 447 652 9.0E-11
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 368 662 9.0E-11
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 448 685 9.0E-11
sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 494 652 9.0E-11
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 485 655 9.0E-11
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 454 682 9.0E-11
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 374 616 1.0E-10
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 537 693 1.0E-10
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 471 658 1.0E-10
sp|A1DDL6|MDV1_NEOFI Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 372 567 1.0E-10
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 447 652 1.0E-10
sp|Q6PFM9|WDR48_DANRE WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 447 652 1.0E-10
sp|Q2U5Z8|MDV1_ASPOR Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 372 567 1.0E-10
sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 443 662 1.0E-10
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 448 653 1.0E-10
sp|Q32PG3|WDR48_BOVIN WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 447 652 1.0E-10
sp|Q8TAF3|WDR48_HUMAN WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 447 652 1.0E-10
sp|Q5RAW8|WDR48_PONAB WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 447 652 1.0E-10
sp|Q8TED0|UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 510 690 1.0E-10
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 471 672 1.0E-10
sp|A7TNS8|CAF4_VANPO CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 372 559 1.0E-10
sp|Q16MY0|WDR48_AEDAE WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 443 704 1.0E-10
sp|O42937|COPB2_SCHPO Probable coatomer subunit beta' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec27 PE=3 SV=2 473 694 1.0E-10
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 374 650 2.0E-10
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 374 650 2.0E-10
sp|P79147|GBB3_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 443 662 2.0E-10
sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 495 662 2.0E-10
sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 495 662 2.0E-10
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 494 696 2.0E-10
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 469 662 2.0E-10
sp|Q0CJD8|MDV1_ASPTN Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 372 567 2.0E-10
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 551 690 2.0E-10
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 551 690 2.0E-10
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 551 690 2.0E-10
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 551 690 2.0E-10
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 551 690 2.0E-10
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 551 690 2.0E-10
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 459 658 2.0E-10
sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 443 663 2.0E-10
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 459 669 2.0E-10
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 533 654 2.0E-10
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 374 663 2.0E-10
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 374 663 2.0E-10
sp|Q4WVS4|MDV1_ASPFU Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 372 567 2.0E-10
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 464 659 2.0E-10
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 447 661 2.0E-10
sp|P36037|DOA1_YEAST Protein DOA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA1 PE=1 SV=1 390 653 2.0E-10
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 383 656 2.0E-10
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 375 650 2.0E-10
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 492 676 3.0E-10
sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 443 662 3.0E-10
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 551 690 3.0E-10
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 448 653 3.0E-10
sp|Q8BH57|WDR48_MOUSE WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 447 652 3.0E-10
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 494 695 3.0E-10
sp|A7MB12|UTP15_BOVIN U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 492 690 3.0E-10
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 364 608 4.0E-10
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 374 611 4.0E-10
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 537 695 4.0E-10
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 469 662 4.0E-10
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 469 662 4.0E-10
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 469 662 4.0E-10
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 464 659 4.0E-10
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 464 659 4.0E-10
sp|Q9P7I3|MDV1_SCHPO Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 487 696 4.0E-10
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 467 658 4.0E-10
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 473 696 5.0E-10
sp|O95170|CDRT1_HUMAN CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 374 557 5.0E-10
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 374 652 5.0E-10
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 551 690 5.0E-10
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 469 662 5.0E-10
sp|C5MJE8|LIS1_CANTT Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 464 655 5.0E-10
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 373 576 5.0E-10
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 533 689 5.0E-10
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 537 701 6.0E-10
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 537 701 6.0E-10
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 351 650 6.0E-10
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 430 628 6.0E-10
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 533 654 6.0E-10
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 374 566 6.0E-10
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 354 658 6.0E-10
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 459 658 7.0E-10
sp|Q8C7V3|UTP15_MOUSE U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 510 690 7.0E-10
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 374 637 8.0E-10
sp|A1CBP8|MDV1_ASPCL Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 373 609 9.0E-10
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 551 672 9.0E-10
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 537 712 1.0E-09
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 374 608 1.0E-09
sp|Q5XX13|FBW10_HUMAN F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2 374 555 1.0E-09
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 464 650 1.0E-09
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 495 662 1.0E-09
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 459 658 1.0E-09
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 537 695 1.0E-09
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 470 660 2.0E-09
sp|Q4P8R5|MDV1_USTMA Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 497 659 2.0E-09
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 459 652 2.0E-09
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 526 689 2.0E-09
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 372 645 2.0E-09
sp|Q5AXW3|MDV1_EMENI Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 372 567 2.0E-09
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 464 650 2.0E-09
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 464 650 2.0E-09
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 464 650 2.0E-09
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 464 650 2.0E-09
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 464 650 2.0E-09
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 510 690 2.0E-09
sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 459 659 2.0E-09
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 464 650 2.0E-09
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 374 566 2.0E-09
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 374 566 2.0E-09
sp|A7TNS8|CAF4_VANPO CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 430 652 2.0E-09
sp|P0CS44|MDV1_CRYNJ Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 544 654 3.0E-09
sp|P0CS45|MDV1_CRYNB Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 544 654 3.0E-09
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 374 652 3.0E-09
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 532 696 4.0E-09
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 459 658 4.0E-09
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 495 662 4.0E-09
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 464 624 4.0E-09
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 464 624 4.0E-09
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 459 661 6.0E-09
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 368 653 6.0E-09
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 577 696 7.0E-09
sp|Q6Q0C0|TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 376 650 7.0E-09
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 494 693 7.0E-09
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 374 570 8.0E-09
sp|P49177|GBB_ARATH Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1 469 661 8.0E-09
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 498 694 8.0E-09
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 459 663 8.0E-09
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 364 568 9.0E-09
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 359 650 9.0E-09
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 498 694 9.0E-09
sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 376 650 9.0E-09
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 520 650 9.0E-09
sp|A7TNS8|CAF4_VANPO CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 374 568 9.0E-09
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 374 570 1.0E-08
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 364 568 1.0E-08
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 537 707 1.0E-08
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 537 712 1.0E-08
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 533 655 1.0E-08
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 374 652 1.0E-08
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 472 690 1.0E-08
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 374 660 1.0E-08
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 589 710 1.0E-08
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 374 570 2.0E-08
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 355 574 2.0E-08
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 579 696 2.0E-08
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 579 696 2.0E-08
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 579 696 2.0E-08
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 579 696 2.0E-08
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 579 696 2.0E-08
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 579 696 2.0E-08
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 579 696 2.0E-08
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 579 696 2.0E-08
sp|Q20636|GBB2_CAEEL Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 459 663 2.0E-08
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 462 650 2.0E-08
sp|Q9P7I3|MDV1_SCHPO Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 374 609 2.0E-08
sp|Q5REE0|UTP15_PONAB U3 small nucleolar RNA-associated protein 15 homolog OS=Pongo abelii GN=UTP15 PE=2 SV=1 551 659 2.0E-08
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 374 570 3.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 563 655 3.0E-08
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 498 694 3.0E-08
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 498 694 3.0E-08
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 464 651 3.0E-08
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 345 537 4.0E-08
sp|Q5SUS0|FBW10_MOUSE F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 366 556 4.0E-08
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 554 663 4.0E-08
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 533 702 4.0E-08
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 387 650 4.0E-08
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 579 696 4.0E-08
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 373 650 4.0E-08
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 498 694 4.0E-08
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 589 710 4.0E-08
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 589 710 4.0E-08
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 374 566 4.0E-08
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 374 611 5.0E-08
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 533 702 5.0E-08
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 533 702 5.0E-08
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 577 696 6.0E-08
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 554 663 6.0E-08
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 554 663 6.0E-08
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 554 663 6.0E-08
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 558 655 6.0E-08
sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 459 662 6.0E-08
sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 459 662 6.0E-08
sp|P62873|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 459 662 6.0E-08
sp|P62872|GBB1_CANLF Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 459 662 6.0E-08
sp|P62871|GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 459 662 6.0E-08
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 533 702 6.0E-08
sp|Q5R5W8|GBB1_PONAB Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 443 662 6.0E-08
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 498 694 6.0E-08
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 498 694 6.0E-08
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 554 663 7.0E-08
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 558 656 7.0E-08
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 554 654 8.0E-08
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 560 685 8.0E-08
sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 374 611 8.0E-08
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 452 650 8.0E-08
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 554 663 9.0E-08
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 554 654 1.0E-07
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 374 629 1.0E-07
sp|A8PTE4|MDV1_MALGO Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 370 568 1.0E-07
sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 488 661 1.0E-07
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 565 659 1.0E-07
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 507 697 1.0E-07
sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 459 661 1.0E-07
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 507 697 1.0E-07
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 572 696 2.0E-07
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 577 688 2.0E-07
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 579 696 2.0E-07
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 537 695 2.0E-07
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 537 695 2.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 579 696 2.0E-07
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 494 667 2.0E-07
sp|Q6CJ50|MDV1_KLULA Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 498 697 2.0E-07
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 494 692 2.0E-07
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 589 710 2.0E-07
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 472 684 2.0E-07
sp|Q9DC48|PRP17_MOUSE Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1 465 651 2.0E-07
sp|O60508|PRP17_HUMAN Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1 465 651 2.0E-07
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 536 696 3.0E-07
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 536 696 3.0E-07
sp|Q58D00|FBXW2_BOVIN F-box/WD repeat-containing protein 2 OS=Bos taurus GN=FBXW2 PE=2 SV=1 537 669 3.0E-07
sp|Q9UKT8|FBXW2_HUMAN F-box/WD repeat-containing protein 2 OS=Homo sapiens GN=FBXW2 PE=1 SV=2 537 669 3.0E-07
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 470 655 4.0E-07
sp|Q6TMK6|GBB1_CRIGR Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 459 662 4.0E-07
sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 498 693 4.0E-07
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 485 692 4.0E-07
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 505 662 5.0E-07
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 532 662 5.0E-07
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 505 662 5.0E-07
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 505 662 5.0E-07
sp|O74184|WAT1_SCHPO WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 464 677 5.0E-07
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 374 568 6.0E-07
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 527 651 6.0E-07
sp|B2RZ17|FBXW2_RAT F-box/WD repeat-containing protein 2 OS=Rattus norvegicus GN=Fbxw2 PE=2 SV=1 537 669 6.0E-07
sp|Q5F3D7|UTP15_CHICK U3 small nucleolar RNA-associated protein 15 homolog OS=Gallus gallus GN=UTP15 PE=2 SV=1 510 690 6.0E-07
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 375 651 6.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 579 696 7.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 579 696 7.0E-07
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 466 631 7.0E-07
sp|Q9DCE5|PK1IP_MOUSE p21-activated protein kinase-interacting protein 1 OS=Mus musculus GN=Pak1ip1 PE=1 SV=2 473 613 7.0E-07
sp|Q60584|FBXW2_MOUSE F-box/WD repeat-containing protein 2 OS=Mus musculus GN=Fbxw2 PE=2 SV=2 537 669 7.0E-07
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 374 608 7.0E-07
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 554 687 7.0E-07
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 483 650 8.0E-07
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 510 662 8.0E-07
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 485 692 9.0E-07
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 505 662 9.0E-07
sp|Q5AXW3|MDV1_EMENI Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 494 660 1.0E-06
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 374 652 1.0E-06
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 485 692 1.0E-06
sp|Q6GMD2|WDR61_XENLA WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 375 651 1.0E-06
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 500 652 1.0E-06
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 575 693 2.0E-06
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 540 673 2.0E-06
sp|A8PTE4|MDV1_MALGO Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 531 659 2.0E-06
sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 465 661 2.0E-06
sp|A4RJV3|MDV1_MAGO7 Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 494 667 2.0E-06
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 537 693 2.0E-06
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 427 569 2.0E-06
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 466 656 2.0E-06
sp|A1CBP8|MDV1_ASPCL Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 494 696 2.0E-06
sp|A1CBP8|MDV1_ASPCL Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 571 652 2.0E-06
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 387 608 2.0E-06
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 588 693 2.0E-06
sp|A7THX0|MDV1_VANPO Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 498 696 2.0E-06
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 493 692 2.0E-06
sp|Q75AV4|PFS2_ASHGO Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 500 658 2.0E-06
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 596 696 3.0E-06
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 459 661 3.0E-06
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 514 690 3.0E-06
sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 499 693 3.0E-06
sp|Q2H139|MDV1_CHAGB Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 494 667 3.0E-06
sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 577 718 3.0E-06
sp|E3LB80|EIF3I_PUCGT Eukaryotic translation initiation factor 3 subunit I OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=TIF34 PE=3 SV=2 579 662 3.0E-06
sp|E3LB80|EIF3I_PUCGT Eukaryotic translation initiation factor 3 subunit I OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=TIF34 PE=3 SV=2 514 692 3.0E-06
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 374 617 4.0E-06
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 374 617 4.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 579 696 4.0E-06
sp|Q4WVS4|MDV1_ASPFU Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 494 696 4.0E-06
sp|Q2T9T9|FBXW9_BOVIN F-box/WD repeat-containing protein 9 OS=Bos taurus GN=FBXW9 PE=2 SV=1 539 692 4.0E-06
sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 374 617 5.0E-06
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 567 652 6.0E-06
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 535 697 6.0E-06
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 533 689 6.0E-06
sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 374 617 6.0E-06
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 466 663 7.0E-06
sp|A7ETB3|MDV1_SCLS1 Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 494 667 7.0E-06
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 466 655 7.0E-06
sp|Q4WVS4|MDV1_ASPFU Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 571 652 7.0E-06
sp|Q3KQ62|WDR83_XENLA WD repeat domain-containing protein 83 OS=Xenopus laevis GN=wdr83 PE=2 SV=1 533 654 7.0E-06
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 374 489 8.0E-06
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 577 654 8.0E-06
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 574 683 8.0E-06
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 374 489 9.0E-06
sp|O74184|WAT1_SCHPO WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 514 652 9.0E-06
sp|A7TNS8|CAF4_VANPO CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 560 661 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|174
MARKRIFPMSEWAPAQEAMLGGDLLPLTAGSEQQRSSALASTTAHEKRHRSLSLSLPWRRPKVSSFAHLELHNVL
QDAGDAVDDGHDAHEPVSDHDRTHGASSTFKGFLRRASLSFKGMVHRRASCAAGDILADHQFPLSRPTTSQGTWN
RLRQAASFRHSPSIHDGSTLSSEHFAPNTPNTSHAPIPAMGHEPPIIPLSSGAAAKASIAMQNDGLHHGPSTRWL
HTTPSNEENNDRESGIGIAVSLPFIEVDEVDDEGALVPRQDTNISRLDFITLLPVELSIQVLSYLDAAALFKARS
VSRGWNSVTMNQHIWRESCLRETTTTYATGMPIGPGTGLGIPRILPSNDWHKIYQAKLNLSQRWKGGQARPFYLN
GHMDSIYCLQFDEHKIVSGSRDRTIRVWDMHTLECRLVIGPPEVIKNPNLLQDPEGKATHYATGSERGRTVHSTP
RVVSFAEHHKASILCLQYDDEILVTGSSDATCIVYDVNNGYQPIRRLRHHTAAVLDLAFDKKHIVTCSKDISICV
WDRETGHLLRQLRGHSGPVNAVQMRGNTIVSCSGDFRVKLWNIDTGKNIREFVGHTKGLACSQFSEDGRYVASAG
NDKVIRIWDANTGECLREMKAHDNLVRSLYIDSVSGRLVSGSYDTDIKVWDMETGNQLLDFPRWHASWVLSAKSD
YRRIVSTGQDPKILIMDFGAGVDGIELLESDNVSGLCPKTRAI*
Coding >OphauB2|174
ATGGCTAGGAAGCGCATATTTCCTATGAGTGAGTGGGCGCCTGCGCAGGAGGCAATGCTCGGTGGCGACTTGCTG
CCGCTGACGGCTGGCTCGGAGCAGCAACGAAGCTCAGCGCTGGCCAGCACTACTGCACACGAGAAGCGACACCGG
AGCTTAAGTCTGTCTCTGCCGTGGCGGCGCCCCAAGGTCTCCTCGTTTGCTCATCTTGAGTTACACAACGTACTG
CAAGACGCTGGTGATGCCGTTGATGATGGACATGACGCGCACGAGCCCGTTAGTGACCACGACCGCACTCATGGC
GCCTCGTCAACTTTTAAAGGTTTCCTCCGCAGGGCCTCTCTGTCTTTCAAGGGCATGGTACACCGACGCGCTTCG
TGTGCGGCAGGAGACATACTGGCCGACCATCAGTTCCCACTCTCAAGACCAACCACCTCGCAAGGTACTTGGAAT
CGCCTGCGCCAGGCTGCAAGTTTTCGCCATTCACCATCTATCCACGACGGCTCGACTCTATCCTCTGAACACTTT
GCTCCCAACACTCCGAATACCTCTCACGCTCCTATACCTGCCATGGGGCATGAACCTCCCATCATCCCGCTGAGC
TCTGGCGCTGCAGCAAAGGCTTCGATAGCCATGCAAAACGACGGGCTGCATCACGGTCCAAGCACTCGCTGGCTG
CATACGACACCGAGCAACGAGGAAAACAATGATCGAGAAAGTGGCATCGGTATCGCCGTGTCTCTGCCTTTTATC
GAGGTGGATGAAGTCGACGACGAGGGCGCGCTTGTACCCAGGCAGGACACTAATATTAGCAGGCTTGACTTTATC
ACGTTGCTCCCGGTCGAGCTTTCTATCCAGGTGCTGTCGTATCTCGACGCTGCGGCTCTCTTCAAAGCGCGCAGC
GTTTCTCGAGGATGGAACAGTGTCACGATGAATCAACACATTTGGCGCGAATCCTGTCTCCGAGAGACGACGACA
ACGTATGCCACGGGCATGCCCATTGGGCCAGGAACCGGATTGGGAATCCCACGCATTCTTCCAAGCAACGACTGG
CACAAGATTTACCAGGCCAAGCTGAATCTGAGCCAGCGCTGGAAGGGTGGACAGGCCCGACCGTTCTATCTCAAT
GGACACATGGACAGCATCTACTGCTTACAGTTTGACGAGCACAAGATTGTCTCTGGATCTCGCGACAGGACGATT
CGTGTTTGGGATATGCATACGCTTGAGTGCCGTCTTGTAATTGGTCCGCCAGAAGTAATTAAAAATCCCAACTTG
CTTCAGGATCCTGAAGGCAAGGCGACGCATTATGCGACTGGGTCGGAGCGTGGGCGGACGGTGCACTCGACGCCT
CGCGTGGTGTCTTTTGCTGAACATCACAAGGCATCAATTCTGTGCTTGCAGTACGATGACGAAATTCTTGTGACG
GGGTCTTCGGACGCCACATGCATCGTGTACGACGTCAACAATGGCTACCAGCCGATTCGAAGGCTGCGCCACCAC
ACAGCTGCAGTGCTAGACTTGGCTTTTGACAAGAAGCACATTGTGACATGCAGCAAAGACATTAGCATCTGCGTC
TGGGACCGTGAGACGGGCCATTTGCTGCGGCAGCTCCGCGGGCACTCGGGACCTGTCAACGCGGTACAGATGCGA
GGCAACACGATTGTTTCATGCTCAGGCGACTTCCGCGTCAAGCTGTGGAACATTGACACGGGCAAGAATATTCGC
GAGTTTGTTGGACACACAAAGGGGCTGGCATGCTCGCAGTTTTCCGAGGACGGGCGCTACGTGGCATCGGCCGGC
AACGACAAGGTTATACGCATTTGGGATGCCAACACGGGCGAGTGTCTGCGCGAAATGAAGGCACACGATAATCTG
GTGCGCAGTCTGTACATTGACAGCGTGAGTGGACGCTTGGTCAGCGGCAGCTACGACACCGACATTAAAGTGTGG
GACATGGAGACGGGCAACCAGCTGCTCGACTTTCCCCGCTGGCATGCCAGCTGGGTGCTCAGCGCCAAGAGCGAC
TATAGACGCATCGTGAGCACGGGACAAGATCCCAAGATTCTCATCATGGACTTTGGCGCCGGCGTTGATGGCATC
GAGCTGCTCGAGAGCGACAACGTATCTGGACTATGCCCAAAGACACGAGCCATTTAA
Transcript >OphauB2|174
ATGGCTAGGAAGCGCATATTTCCTATGAGTGAGTGGGCGCCTGCGCAGGAGGCAATGCTCGGTGGCGACTTGCTG
CCGCTGACGGCTGGCTCGGAGCAGCAACGAAGCTCAGCGCTGGCCAGCACTACTGCACACGAGAAGCGACACCGG
AGCTTAAGTCTGTCTCTGCCGTGGCGGCGCCCCAAGGTCTCCTCGTTTGCTCATCTTGAGTTACACAACGTACTG
CAAGACGCTGGTGATGCCGTTGATGATGGACATGACGCGCACGAGCCCGTTAGTGACCACGACCGCACTCATGGC
GCCTCGTCAACTTTTAAAGGTTTCCTCCGCAGGGCCTCTCTGTCTTTCAAGGGCATGGTACACCGACGCGCTTCG
TGTGCGGCAGGAGACATACTGGCCGACCATCAGTTCCCACTCTCAAGACCAACCACCTCGCAAGGTACTTGGAAT
CGCCTGCGCCAGGCTGCAAGTTTTCGCCATTCACCATCTATCCACGACGGCTCGACTCTATCCTCTGAACACTTT
GCTCCCAACACTCCGAATACCTCTCACGCTCCTATACCTGCCATGGGGCATGAACCTCCCATCATCCCGCTGAGC
TCTGGCGCTGCAGCAAAGGCTTCGATAGCCATGCAAAACGACGGGCTGCATCACGGTCCAAGCACTCGCTGGCTG
CATACGACACCGAGCAACGAGGAAAACAATGATCGAGAAAGTGGCATCGGTATCGCCGTGTCTCTGCCTTTTATC
GAGGTGGATGAAGTCGACGACGAGGGCGCGCTTGTACCCAGGCAGGACACTAATATTAGCAGGCTTGACTTTATC
ACGTTGCTCCCGGTCGAGCTTTCTATCCAGGTGCTGTCGTATCTCGACGCTGCGGCTCTCTTCAAAGCGCGCAGC
GTTTCTCGAGGATGGAACAGTGTCACGATGAATCAACACATTTGGCGCGAATCCTGTCTCCGAGAGACGACGACA
ACGTATGCCACGGGCATGCCCATTGGGCCAGGAACCGGATTGGGAATCCCACGCATTCTTCCAAGCAACGACTGG
CACAAGATTTACCAGGCCAAGCTGAATCTGAGCCAGCGCTGGAAGGGTGGACAGGCCCGACCGTTCTATCTCAAT
GGACACATGGACAGCATCTACTGCTTACAGTTTGACGAGCACAAGATTGTCTCTGGATCTCGCGACAGGACGATT
CGTGTTTGGGATATGCATACGCTTGAGTGCCGTCTTGTAATTGGTCCGCCAGAAGTAATTAAAAATCCCAACTTG
CTTCAGGATCCTGAAGGCAAGGCGACGCATTATGCGACTGGGTCGGAGCGTGGGCGGACGGTGCACTCGACGCCT
CGCGTGGTGTCTTTTGCTGAACATCACAAGGCATCAATTCTGTGCTTGCAGTACGATGACGAAATTCTTGTGACG
GGGTCTTCGGACGCCACATGCATCGTGTACGACGTCAACAATGGCTACCAGCCGATTCGAAGGCTGCGCCACCAC
ACAGCTGCAGTGCTAGACTTGGCTTTTGACAAGAAGCACATTGTGACATGCAGCAAAGACATTAGCATCTGCGTC
TGGGACCGTGAGACGGGCCATTTGCTGCGGCAGCTCCGCGGGCACTCGGGACCTGTCAACGCGGTACAGATGCGA
GGCAACACGATTGTTTCATGCTCAGGCGACTTCCGCGTCAAGCTGTGGAACATTGACACGGGCAAGAATATTCGC
GAGTTTGTTGGACACACAAAGGGGCTGGCATGCTCGCAGTTTTCCGAGGACGGGCGCTACGTGGCATCGGCCGGC
AACGACAAGGTTATACGCATTTGGGATGCCAACACGGGCGAGTGTCTGCGCGAAATGAAGGCACACGATAATCTG
GTGCGCAGTCTGTACATTGACAGCGTGAGTGGACGCTTGGTCAGCGGCAGCTACGACACCGACATTAAAGTGTGG
GACATGGAGACGGGCAACCAGCTGCTCGACTTTCCCCGCTGGCATGCCAGCTGGGTGCTCAGCGCCAAGAGCGAC
TATAGACGCATCGTGAGCACGGGACAAGATCCCAAGATTCTCATCATGGACTTTGGCGCCGGCGTTGATGGCATC
GAGCTGCTCGAGAGCGACAACGTATCTGGACTATGCCCAAAGACACGAGCCATTTAA
Gene >OphauB2|174
ATGGCTAGGAAGCGCATATTTCCTATGAGTGAGTGGGCGCCTGCGCAGGAGGCAATGCTCGGTGGCGACTTGCTG
CCGCTGACGGCTGGCTCGGAGCAGCAACGAAGCTCAGCGCTGGCCAGCACTACTGCACACGAGAAGCGACACCGG
AGCTTAAGTCTGTCTCTGCCGTGGCGGCGCCCCAAGGTCTCCTCGTTTGCTCATCTTGAGTTACACAACGTACTG
CAAGACGCTGGTGATGCCGTTGATGATGGACATGACGCGCACGAGCCCGTTAGTGACCACGACCGCACTCATGGC
GCCTCGTCAACTTTTAAAGGTTTCCTCCGCAGGGCCTCTCTGTCTTTCAAGGGCATGGTACACCGACGCGCTTCG
TGTGCGGCAGGAGACATACTGGCCGACCATCAGTTCCCACTCTCAAGACCAACCACCTCGCAAGGTACTTGGAAT
CGCCTGCGCCAGGCTGCAAGTTTTCGCCATTCACCATCTATCCACGACGGCTCGACTCTATCCTCTGAACACTTT
GCTCCCAACACTCCGAATACCTCTCACGCTCCTATACCTGCCATGGGGCATGAACCTCCCATCATCCCGCTGAGC
TCTGGCGCTGCAGCAAAGGCTTCGATAGCCATGCAAAACGACGGGCTGCATCACGGTCCAAGCACTCGCTGGCTG
CATACGACACCGAGCAACGAGGAAAACAATGATCGAGAAAGTGGCATCGGTATCGCCGTGTCTCTGCCTTTTATC
GAGGTGGATGAAGTCGACGACGAGGGCGCGCTTGTACCCAGGCAGGACACTAATATTAGCAGGCTTGACTTTATC
ACGTTGCTCCCGGTCGAGCTTTCTATCCAGGTGCTGTCGTATCTCGACGCTGCGGCTCTCTTCAAAGCGCGCAGC
GTTTCTCGAGGATGGAACAGTGTCACGATGAATCAACACATTTGGCGCGAATCCTGTCTCCGAGAGACGACGACA
ACGTATGCCACGGGCATGCCCATTGGGCCAGGAACCGGATTGGGAATCCCACGCATTCTTCCAAGCAACGACTGG
CACAAGATTTACCAGGCCAAGCTGAATCTGAGCCAGCGCTGGAAGGGTGGACAGGCCCGACCGTTCTATCTCAAT
GGACACATGGACAGCATCTACTGCTTACAGTTTGACGAGTAAGTTTGGCTCTCACCAAGCTGGCCAAGACGACCC
TTTACTGACTCTGATGCCCTGTTTAGGCACAAGATTGTCTCTGGATCTCGCGACAGGACGATTCGTGTTTGGGAT
ATGCATACGCTTGAGTGCCGTCTTGTAATTGGTCCGCCAGAAGTAATTAAAAATCCCAACTTGCTTCAGGATCCT
GAAGGCAAGGCGACGCATTATGCGACTGGGTCGGAGCGTGGGCGGACGGTGCACTCGACGCCTCGCGTGGTGTCT
TTTGCTGAACATCACAAGGCATCAATTCTGTGCTTGCAGTACGATGACGAAATTCTTGTGACGGGGTCTTCGGAC
GCCACATGCATCGTGTACGACGTCAACAATGGCTACCAGCCGATTCGAAGGCTGCGCCACCACACAGCTGCAGTG
CTAGACTTGGCTTTTGACAAGAAGCACATTGTGACATGCAGCAAAGACATTAGCATCTGCGTCTGGGACCGTGAG
ACGGGCCATTTGCTGCGGCAGCTCCGCGGGCACTCGGGACCTGTCAACGCGGTACAGATGCGAGGCAACACGATT
GTTTCATGCTCAGGCGACTTCCGCGTCAAGCTGTGGAACATTGACACGGGCAAGAATATTCGCGAGTTTGTTGGA
CACACAAAGGGGCTGGCATGCTCGCAGTTTTCCGAGGACGGGCGCTACGTGGCATCGGCCGGCAACGACAAGGTT
ATACGCATTTGGGATGCCAACACGGGCGAGTGTCTGCGCGAAATGAAGGCACACGATAATCTGGTGCGCAGTCTG
TACATTGACAGCGTGAGTGGACGCTTGGTCAGCGGCAGCTACGACACCGACATTAAAGTGTGGGACATGGAGACG
GGCAACCAGCTGCTCGACTTTCCCCGCTGGCATGCCAGCTGGGTGCTCAGCGCCAAGAGCGACTATAGACGCATC
GTGAGCACGGGACAAGATCCCAAGATTCTCATCATGGACTTTGGCGCCGGCGTTGATGGCATCGAGCTGCTCGAG
AGCGACAACGTATCTGGACTATGCCCAAAGACACGAGCCATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail