Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1735
Gene name
LocationContig_15:67315..72931
Strand+
Gene length (bp)5616
Transcript length (bp)5184
Coding sequence length (bp)5184
Protein length (aa) 1728

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08429 PLU-1 PLU-1-like protein 3.4E-108 906 1254
PF02373 JmjC JmjC domain, hydroxylase 3.1E-31 630 723
PF01388 ARID ARID/BRIGHT DNA binding domain 3.0E-21 165 249
PF00628 PHD PHD-finger 5.1E-11 458 503
PF02375 JmjN jmjN domain 1.2E-14 96 129
PF02928 zf-C5HC2 C5HC2 zinc finger 4.8E-12 833 891

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDV4|LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lid2 PE=1 SV=1 455 1509 3.0E-145
sp|Q38JA7|KDM5C_CANLF Lysine-specific demethylase 5C OS=Canis lupus familiaris GN=KDM5C PE=2 SV=1 94 1398 3.0E-136
sp|Q9UT79|MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msc1 PE=3 SV=1 457 1477 8.0E-122
sp|Q9BY66|KDM5D_HUMAN Lysine-specific demethylase 5D OS=Homo sapiens GN=KDM5D PE=1 SV=2 94 1399 4.0E-119
sp|Q5XUN4|KDM5D_PANTR Lysine-specific demethylase 5D OS=Pan troglodytes GN=KDM5D PE=2 SV=1 94 1399 7.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDV4|LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lid2 PE=1 SV=1 455 1509 3.0E-145
sp|Q38JA7|KDM5C_CANLF Lysine-specific demethylase 5C OS=Canis lupus familiaris GN=KDM5C PE=2 SV=1 94 1398 3.0E-136
sp|Q9UT79|MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msc1 PE=3 SV=1 457 1477 8.0E-122
sp|Q9BY66|KDM5D_HUMAN Lysine-specific demethylase 5D OS=Homo sapiens GN=KDM5D PE=1 SV=2 94 1399 4.0E-119
sp|Q5XUN4|KDM5D_PANTR Lysine-specific demethylase 5D OS=Pan troglodytes GN=KDM5D PE=2 SV=1 94 1399 7.0E-118
sp|Q3UXZ9|KDM5A_MOUSE Lysine-specific demethylase 5A OS=Mus musculus GN=Kdm5a PE=1 SV=2 456 1399 5.0E-104
sp|A1YVX4|KDM5C_PIG Lysine-specific demethylase 5C OS=Sus scrofa GN=KDM5C PE=2 SV=1 94 1398 1.0E-102
sp|P29375|KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens GN=KDM5A PE=1 SV=3 456 1399 2.0E-102
sp|Q30DN6|KDM5D_CANLF Lysine-specific demethylase 5D OS=Canis lupus familiaris GN=KDM5D PE=2 SV=1 456 1390 3.0E-101
sp|P41230|KDM5C_MOUSE Lysine-specific demethylase 5C OS=Mus musculus GN=Kdm5c PE=1 SV=4 453 1398 4.0E-100
sp|P41229|KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens GN=KDM5C PE=1 SV=2 453 1398 4.0E-100
sp|Q62240|KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus GN=Kdm5d PE=2 SV=2 453 1390 7.0E-100
sp|Q9VMJ7|KDM5_DROME Lysine-specific demethylase lid OS=Drosophila melanogaster GN=lid PE=1 SV=1 453 1331 3.0E-99
sp|Q6IQX0|KD5BB_DANRE Lysine-specific demethylase 5B-B OS=Danio rerio GN=kdm5bb PE=2 SV=2 456 1254 2.0E-97
sp|Q5F3R2|KDM5B_CHICK Lysine-specific demethylase 5B OS=Gallus gallus GN=KDM5B PE=2 SV=1 350 1394 1.0E-95
sp|Q9UGL1|KDM5B_HUMAN Lysine-specific demethylase 5B OS=Homo sapiens GN=KDM5B PE=1 SV=3 452 1140 1.0E-91
sp|Q80Y84|KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus GN=Kdm5b PE=1 SV=1 445 1140 7.0E-90
sp|Q9US53|JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=jmj2 PE=3 SV=1 499 870 5.0E-83
sp|Q61T02|KDM5_CAEBR Lysine-specific demethylase rbr-2 OS=Caenorhabditis briggsae GN=rbr-2 PE=3 SV=2 458 1087 8.0E-78
sp|Q23541|KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans GN=rbr-2 PE=1 SV=2 458 858 1.0E-76
sp|C0SUT9|JMJ16_ARATH Putative lysine-specific demethylase JMJ16 OS=Arabidopsis thaliana GN=JMJ16 PE=2 SV=1 509 901 5.0E-66
sp|Q53WJ1|JM703_ORYSJ Lysine-specific demethylase JMJ703 OS=Oryza sativa subsp. japonica GN=JMJ703 PE=1 SV=1 508 758 4.0E-63
sp|Q8GUI6|JMJ14_ARATH Probable lysine-specific demethylase JMJ14 OS=Arabidopsis thaliana GN=JMJ14 PE=1 SV=1 506 880 2.0E-62
sp|P47156|JHD2_YEAST Histone demethylase JHD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JHD2 PE=1 SV=1 458 786 8.0E-62
sp|O64752|JMJ15_ARATH Lysine-specific demethylase JMJ15 OS=Arabidopsis thaliana GN=JMJ15 PE=2 SV=1 508 795 2.0E-56
sp|F4I6G4|JMJ18_ARATH Lysine-specific demethylase JMJ18 OS=Arabidopsis thaliana GN=JMJ18 PE=2 SV=1 508 758 1.0E-55
sp|Q336N8|JM706_ORYSJ Lysine-specific demethylase JMJ706 OS=Oryza sativa subsp. japonica GN=JMJ706 PE=2 SV=1 517 758 5.0E-42
sp|Q1LVC2|JARD2_DANRE Protein Jumonji OS=Danio rerio GN=jarid2b PE=3 SV=2 554 900 2.0E-37
sp|Q10RP4|SE14_ORYSJ Lysine-specific demethylase SE14 OS=Oryza sativa subsp. japonica GN=SE14 PE=3 SV=2 511 758 9.0E-37
sp|Q62315|JARD2_MOUSE Protein Jumonji OS=Mus musculus GN=Jarid2 PE=1 SV=1 554 900 8.0E-36
sp|Q5F363|JARD2_CHICK Protein Jumonji OS=Gallus gallus GN=JARID2 PE=2 SV=1 551 900 1.0E-35
sp|Q92833|JARD2_HUMAN Protein Jumonji OS=Homo sapiens GN=JARID2 PE=1 SV=2 554 900 3.0E-35
sp|Q5N712|JM705_ORYSJ Lysine-specific demethylase JMJ705 OS=Oryza sativa subsp. japonica GN=JMJ705 PE=1 SV=1 517 758 4.0E-35
sp|Q30DN6|KDM5D_CANLF Lysine-specific demethylase 5D OS=Canis lupus familiaris GN=KDM5D PE=2 SV=1 94 251 5.0E-34
sp|Q9STM3|REF6_ARATH Lysine-specific demethylase REF6 OS=Arabidopsis thaliana GN=REF6 PE=1 SV=1 511 755 7.0E-34
sp|P29375|KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens GN=KDM5A PE=1 SV=3 94 251 2.0E-33
sp|Q62240|KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus GN=Kdm5d PE=2 SV=2 94 251 2.0E-33
sp|Q3UXZ9|KDM5A_MOUSE Lysine-specific demethylase 5A OS=Mus musculus GN=Kdm5a PE=1 SV=2 94 251 3.0E-33
sp|P41230|KDM5C_MOUSE Lysine-specific demethylase 5C OS=Mus musculus GN=Kdm5c PE=1 SV=4 94 251 4.0E-33
sp|P41229|KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens GN=KDM5C PE=1 SV=2 94 251 4.0E-33
sp|Q6IQX0|KD5BB_DANRE Lysine-specific demethylase 5B-B OS=Danio rerio GN=kdm5bb PE=2 SV=2 94 282 4.0E-33
sp|Q9VMJ7|KDM5_DROME Lysine-specific demethylase lid OS=Drosophila melanogaster GN=lid PE=1 SV=1 94 341 5.0E-33
sp|Q6BDA0|ELF6_ARATH Probable lysine-specific demethylase ELF6 OS=Arabidopsis thaliana GN=ELF6 PE=1 SV=1 511 795 2.0E-31
sp|Q80Y84|KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus GN=Kdm5b PE=1 SV=1 94 300 3.0E-31
sp|Q9UGL1|KDM5B_HUMAN Lysine-specific demethylase 5B OS=Homo sapiens GN=KDM5B PE=1 SV=3 94 252 4.0E-31
sp|Q5F3R2|KDM5B_CHICK Lysine-specific demethylase 5B OS=Gallus gallus GN=KDM5B PE=2 SV=1 94 316 5.0E-31
sp|Q8L7T6|JMJ19_ARATH Probable inactive lysine-specific demethylase JMJ19 OS=Arabidopsis thaliana GN=JMJ19 PE=2 SV=1 512 758 5.0E-31
sp|Q03214|ECM5_YEAST Protein ECM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM5 PE=1 SV=1 89 251 6.0E-28
sp|Q8VCD7|KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus GN=Kdm4c PE=1 SV=1 513 732 7.0E-28
sp|Q9H3R0|KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens GN=KDM4C PE=1 SV=2 513 732 1.0E-27
sp|Q3U2K5|KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus GN=Kdm4d PE=2 SV=2 554 732 3.0E-26
sp|B2RXH2|KDM4E_HUMAN Lysine-specific demethylase 4E OS=Homo sapiens GN=KDM4E PE=1 SV=1 574 732 3.0E-26
sp|A1A5Q5|KDM4D_RAT Lysine-specific demethylase 4D OS=Rattus norvegicus GN=Kdm4d PE=2 SV=1 554 732 7.0E-26
sp|P39956|RPH1_YEAST DNA damage-responsive transcriptional repressor RPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPH1 PE=1 SV=1 519 732 8.0E-26
sp|Q91VY5|KDM4B_MOUSE Lysine-specific demethylase 4B OS=Mus musculus GN=Kdm4b PE=2 SV=1 513 732 1.0E-25
sp|O94953|KDM4B_HUMAN Lysine-specific demethylase 4B OS=Homo sapiens GN=KDM4B PE=1 SV=4 513 732 1.0E-25
sp|Q9V6L0|KDM4B_DROME Probable lysine-specific demethylase 4B OS=Drosophila melanogaster GN=Kdm4B PE=3 SV=3 554 737 2.0E-25
sp|Q6B0I6|KDM4D_HUMAN Lysine-specific demethylase 4D OS=Homo sapiens GN=KDM4D PE=1 SV=3 574 732 2.0E-25
sp|Q8BW72|KDM4A_MOUSE Lysine-specific demethylase 4A OS=Mus musculus GN=Kdm4a PE=1 SV=3 513 736 6.0E-25
sp|Q5RD88|KDM4A_PONAB Lysine-specific demethylase 4A OS=Pongo abelii GN=KDM4A PE=2 SV=1 487 736 7.0E-25
sp|O75164|KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens GN=KDM4A PE=1 SV=2 487 736 7.0E-25
sp|Q23541|KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans GN=rbr-2 PE=1 SV=2 84 222 3.0E-24
sp|Q9V333|KDM4A_DROME Probable lysine-specific demethylase 4A OS=Drosophila melanogaster GN=Kdm4A PE=1 SV=1 518 732 3.0E-23
sp|Q61T02|KDM5_CAEBR Lysine-specific demethylase rbr-2 OS=Caenorhabditis briggsae GN=rbr-2 PE=3 SV=2 95 222 4.0E-23
sp|Q9U297|KDM4_CAEEL Lysine-specific demethylase 4 OS=Caenorhabditis elegans GN=jmjd-2 PE=3 SV=2 603 736 3.0E-22
sp|Q9US53|JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=jmj2 PE=3 SV=1 59 306 7.0E-22
sp|Q5F363|JARD2_CHICK Protein Jumonji OS=Gallus gallus GN=JARID2 PE=2 SV=1 92 266 2.0E-15
sp|Q62315|JARD2_MOUSE Protein Jumonji OS=Mus musculus GN=Jarid2 PE=1 SV=1 91 266 5.0E-15
sp|Q92833|JARD2_HUMAN Protein Jumonji OS=Homo sapiens GN=JARID2 PE=1 SV=2 66 266 9.0E-15
sp|Q03833|GIS1_YEAST Transcriptional activator/repressor GIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS1 PE=1 SV=1 506 723 2.0E-14
sp|Q03214|ECM5_YEAST Protein ECM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM5 PE=1 SV=1 516 678 2.0E-11
sp|Q1LVC2|JARD2_DANRE Protein Jumonji OS=Danio rerio GN=jarid2b PE=3 SV=2 91 266 4.0E-11
sp|Q9SGH2|MBD9_ARATH Methyl-CpG-binding domain-containing protein 9 OS=Arabidopsis thaliana GN=MBD9 PE=2 SV=1 443 505 5.0E-10
sp|A6PWV5|ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus GN=Arid3c PE=2 SV=2 166 261 8.0E-10
sp|Q6GQD7|ARI3A_XENLA AT-rich interactive domain-containing protein 3A OS=Xenopus laevis GN=arid3a PE=2 SV=1 166 331 1.0E-09
sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 458 504 1.0E-09
sp|A6NKF2|ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens GN=ARID3C PE=3 SV=1 166 261 2.0E-09
sp|A2BEA6|ARI3A_DANRE AT-rich interactive domain-containing protein 3A OS=Danio rerio GN=arid3a PE=1 SV=1 166 258 2.0E-09
sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 458 504 3.0E-09
sp|Q5XGD9|ARI3A_XENTR AT-rich interactive domain-containing protein 3A OS=Xenopus tropicalis GN=arid3a PE=2 SV=1 166 331 4.0E-09
sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 458 502 8.0E-09
sp|Q53WJ1|JM703_ORYSJ Lysine-specific demethylase JMJ703 OS=Oryza sativa subsp. japonica GN=JMJ703 PE=1 SV=1 66 175 1.0E-08
sp|Q4H3P5|DRI_CIOIN Protein dead ringer homolog OS=Ciona intestinalis GN=Ci-DRIL1/2 PE=2 SV=1 166 258 1.0E-08
sp|Q8MQH7|DRI_STRPU Protein dead ringer homolog OS=Strongylocentrotus purpuratus GN=dri PE=2 SV=1 166 249 1.0E-08
sp|Q24573|DRI_DROME Protein dead ringer OS=Drosophila melanogaster GN=retn PE=1 SV=2 166 249 2.0E-08
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 441 504 2.0E-08
sp|Q62431|ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus GN=Arid3a PE=1 SV=1 166 322 3.0E-08
sp|Q68CP9|ARID2_HUMAN AT-rich interactive domain-containing protein 2 OS=Homo sapiens GN=ARID2 PE=1 SV=2 161 251 3.0E-08
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 415 502 4.0E-08
sp|Q8IVW6|ARI3B_HUMAN AT-rich interactive domain-containing protein 3B OS=Homo sapiens GN=ARID3B PE=1 SV=2 166 249 4.0E-08
sp|Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens GN=KMT2C PE=1 SV=3 458 503 5.0E-08
sp|Q8BRH4|KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus GN=Kmt2c PE=1 SV=2 458 503 6.0E-08
sp|P47156|JHD2_YEAST Histone demethylase JHD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JHD2 PE=1 SV=1 94 175 7.0E-08
sp|Q9Z1N7|ARI3B_MOUSE AT-rich interactive domain-containing protein 3B OS=Mus musculus GN=Arid3b PE=2 SV=1 166 249 7.0E-08
sp|Q9HDV4|LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lid2 PE=1 SV=1 84 201 8.0E-08
sp|Q99856|ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens GN=ARID3A PE=1 SV=2 166 249 8.0E-08
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 456 502 1.0E-07
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 456 502 1.0E-07
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 458 502 1.0E-07
sp|Q8GUI6|JMJ14_ARATH Probable lysine-specific demethylase JMJ14 OS=Arabidopsis thaliana GN=JMJ14 PE=1 SV=1 85 159 2.0E-07
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 458 503 2.0E-07
sp|F4I6G4|JMJ18_ARATH Lysine-specific demethylase JMJ18 OS=Arabidopsis thaliana GN=JMJ18 PE=2 SV=1 85 159 3.0E-07
sp|Q96BD5|PF21A_HUMAN PHD finger protein 21A OS=Homo sapiens GN=PHF21A PE=1 SV=1 458 502 3.0E-07
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 458 502 5.0E-07
sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 458 541 5.0E-07
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 458 502 6.0E-07
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 458 502 6.0E-07
sp|Q6PDK2|KMT2D_MOUSE Histone-lysine N-methyltransferase 2D OS=Mus musculus GN=Kmt2d PE=1 SV=2 458 503 6.0E-07
sp|O14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D OS=Homo sapiens GN=KMT2D PE=1 SV=2 458 503 6.0E-07
sp|Q336N8|JM706_ORYSJ Lysine-specific demethylase JMJ706 OS=Oryza sativa subsp. japonica GN=JMJ706 PE=2 SV=1 92 153 7.0E-07
sp|Q03214|ECM5_YEAST Protein ECM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM5 PE=1 SV=1 1299 1441 7.0E-07
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 458 502 9.0E-07
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 458 502 1.0E-06
sp|Q8L7T6|JMJ19_ARATH Probable inactive lysine-specific demethylase JMJ19 OS=Arabidopsis thaliana GN=JMJ19 PE=2 SV=1 80 135 2.0E-06
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 458 502 2.0E-06
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 458 502 2.0E-06
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 458 502 2.0E-06
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 458 502 2.0E-06
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 458 502 2.0E-06
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 457 502 2.0E-06
sp|O64752|JMJ15_ARATH Lysine-specific demethylase JMJ15 OS=Arabidopsis thaliana GN=JMJ15 PE=2 SV=1 92 159 3.0E-06
sp|Q8IN94|OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster GN=osa PE=1 SV=1 166 249 3.0E-06
sp|Q96T23|RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens GN=RSF1 PE=1 SV=2 458 502 4.0E-06
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 457 502 6.0E-06
sp|Q8NFD5|ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens GN=ARID1B PE=1 SV=2 166 249 8.0E-06
sp|Q5ZJ69|ARI5B_CHICK AT-rich interactive domain-containing protein 5B OS=Gallus gallus GN=ARID5B PE=2 SV=1 166 253 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1735
MGSAAAVRTAPAANAGSGNGSSRNSPTATGSTSQPSTRPQRKVNTNGYHPPNTHLPLSAMVSTGLDLTSVERRGQ
PTAIREPVKKATRPHGITEAPTYSPTEDEWRDPLEYIRKISSEASKYGLCKIIPPDSWNPDFAIDTEKFHFRTRK
QELNSVEGRTRANLTYLDGLAKFHKQHGSNLHRLPYVDKKPLDLYRLKKAVESRGGFEKVCKQKKWAEIGRDLGY
SGKIMSSLSTSLKNSYQRWLCPYEEYLRLAKPGVHQQLEQEYGGPLTPSPAQTPLKRHDVQTPSSAKGDSPARQA
LDTLQNSFESLKKETDRDSPMTDAPPAVTPTGGFTAINSGGGFTAVNVAPSSVPRSINGDGHGSTPDAKRVNSPG
PSAKTTPLRPAAALKRQQSFGSLSDSAKKDGDGEKEDNENSSRRSKRLKKDSVPTVAGSHMTMFRPSVPRIPRDE
AALSGHKCEICGRGDDAGSLLVCESCDHSYHGPCLDPPLKRKPDAEWNCPRCLVGDGQFGFEEGGLYSLRQFQQK
ANDFKQGYFERKMPYDHALNCHRPVTEHDVESEFWRLVSDLEETVEVEYGADIHCTTHGSGFPTVERNPKSPYST
DPWNLNVLPFHTDSLFRHIKSDISGMTVPWVYVGMIFSTFCWHNEDHYAYSANYQHFGATKTWYGIPGEDADKFE
AAMKEALKKAGVRVYALDQRAGQFVITFPQAYHAGFNHGFNFNEAVNFAPSDWEPFGLAGVERLQAFRRQPCFSH
DELLWTAAEGSTSLSLTIQTAKWLAPALERIRKREATQRDGFITKHKGSSSHKCRFSGSDESDCPLTFHVQDEDV
QDEDEQCCSHCKAFAYLSRFKCHKSGKVMCILHAGSYACCELSEEHRFLGKNHSLYYRKSDEAVEATYNRVFEKA
RTPEIWEEKYAKMLDEEVKPPLKTLRTMLHEGERIPWELPSLPILKQFVERCNDWVEEATNYIVRKQQNRRKNER
VWQSSLRKSVSLASQDQKERELRNVSNIYRLLGDAERIGFECPEIGQLQERATAIKEFQVGAARALENTTSIGTQ
EIEKLIEEGRGFNVDTPEVDRLSRVLDQMRWNEKANENRGVILTLKEVQDLIDEGKRLEIPSYNDFVKYYRDQLQ
LGEAWERKVKEIIEADIVHYPQLEALSKQAQANALPVSPETLAKVDQILHKQREAQRQIHDIVDRCRNADLRKRP
KYSEVVDISKKLEDLNSKPEGTLDLENEKKRHEDWMRKGKRLFGKSNAPLHILKSHLEYVLERNVSCFEVDHDTP
RLPGEPSSRDTSPERAAGTEWQESRPRQVFCICRKIEHGMMIECELCHEWYHYKCLKIARGKIKDDELYTCPICD
WRMKIPRDAARPKLEDLLSLAEEMPGLPFQPEEEEVLNGIISNSQAFRDHIARYCNPLLSTEAEADTQRFYLRKL
EGAEVLLAHETNFFRQELHKWCPVAPQPPPILQVSLSTRKPRPTKLQKMLAEYGVQNPDDLPEHAKGKANSLRRK
AANAEAAAAAAAAAAAQSSGSGVILPTSSHGSYAGPTFYARPIQSAMVNVDVSMHSHPSKAGPDHSRDHSEADSG
VDDSNIHPGFLGAGGPQLVVDNSVLTLEERLLRGQEDGINLQTEAGKSKALEILGRTEVGRKQAEKIWGSDVWGS
STRRSLSDQDGSMTPVEMNDLMHHKQDEGNVEQMFKEMTNQDEDEDQKKKENTSNGPVTAESLESERNGLDALLD
GE*
Coding >OphauB2|1735
ATGGGGTCGGCTGCAGCTGTTCGCACTGCACCGGCGGCCAATGCAGGCAGTGGAAATGGGAGCTCGCGCAACTCA
CCAACCGCTACCGGCTCCACAAGCCAGCCATCTACAAGACCTCAGCGCAAGGTCAATACCAACGGCTATCATCCC
CCCAATACCCACTTGCCCTTGAGCGCCATGGTTAGCACTGGTCTCGATTTGACCTCGGTCGAGCGCCGTGGCCAG
CCTACTGCCATTCGTGAGCCCGTCAAGAAGGCAACGAGGCCTCATGGCATCACCGAGGCTCCAACTTACTCCCCC
ACTGAGGACGAATGGCGGGACCCGTTAGAATACATCAGAAAAATCTCTTCCGAGGCTTCAAAATATGGACTCTGC
AAAATTATTCCCCCAGACTCGTGGAACCCTGACTTTGCCATTGATACCGAGAAGTTTCATTTTCGGACGAGAAAG
CAGGAGCTAAACTCAGTAGAAGGACGGACCCGTGCCAATTTGACGTACCTCGATGGATTAGCCAAATTTCATAAA
CAGCACGGGAGCAACTTGCACCGACTTCCATATGTCGATAAGAAACCGCTCGATTTGTATCGTCTAAAAAAAGCC
GTCGAATCTCGTGGCGGATTTGAAAAGGTGTGCAAACAAAAAAAATGGGCAGAGATTGGTCGAGATTTGGGCTAT
AGCGGTAAAATAATGTCGTCGTTGTCTACGTCGCTCAAGAACTCTTATCAGAGATGGCTATGTCCCTACGAAGAG
TACCTGCGCCTTGCCAAGCCAGGTGTTCACCAGCAGCTGGAACAAGAATACGGAGGGCCTTTGACTCCGAGCCCG
GCTCAAACTCCGCTTAAGAGACATGATGTTCAAACACCATCCAGCGCTAAAGGAGACTCACCCGCCCGACAGGCA
TTGGATACCCTCCAAAACAGCTTTGAAAGTTTAAAAAAAGAAACGGACCGCGATAGTCCCATGACGGATGCCCCC
CCGGCCGTGACACCCACGGGTGGCTTCACTGCCATCAACTCAGGTGGCGGCTTTACTGCAGTAAATGTGGCACCA
AGCAGCGTGCCTCGCTCCATCAATGGCGACGGCCACGGCTCTACTCCCGATGCTAAGCGAGTCAACAGTCCAGGG
CCGTCGGCCAAAACCACTCCACTGAGACCAGCTGCAGCGTTGAAACGACAGCAAAGCTTTGGCAGTCTATCCGAT
TCAGCCAAGAAGGACGGCGATGGTGAAAAGGAGGATAATGAGAACAGCAGTCGCCGTAGCAAGCGCTTAAAGAAG
GACTCTGTTCCAACTGTGGCTGGATCACATATGACCATGTTCCGCCCATCCGTTCCACGTATTCCTCGCGACGAG
GCAGCCTTGAGTGGACATAAATGCGAGATTTGTGGACGGGGCGATGATGCAGGGTCTCTGCTCGTTTGCGAATCC
TGCGACCACTCGTACCACGGTCCTTGTCTTGATCCGCCACTCAAACGCAAGCCCGACGCTGAGTGGAACTGCCCT
CGTTGCCTTGTCGGCGATGGCCAATTTGGCTTCGAGGAGGGCGGCCTGTACTCTCTCAGACAATTCCAGCAAAAA
GCCAACGACTTTAAACAGGGCTATTTCGAGAGAAAAATGCCATATGACCATGCGCTCAACTGCCATCGCCCTGTC
ACGGAGCATGACGTTGAATCTGAATTTTGGCGCTTGGTGTCTGATTTGGAAGAAACAGTCGAAGTCGAGTACGGT
GCCGATATTCACTGCACGACGCACGGCTCTGGATTTCCAACGGTTGAGAGAAACCCCAAGAGCCCTTATTCTACA
GATCCCTGGAATCTTAATGTCCTGCCATTTCATACTGACAGCTTATTCCGACATATTAAGTCTGATATTTCGGGA
ATGACAGTGCCTTGGGTGTATGTAGGCATGATATTCTCAACGTTTTGTTGGCACAATGAGGACCACTATGCATAC
TCAGCCAACTATCAGCACTTTGGCGCCACCAAGACTTGGTACGGAATTCCGGGAGAAGATGCTGATAAATTCGAG
GCAGCCATGAAAGAAGCGCTCAAGAAGGCTGGCGTGCGCGTTTATGCTCTGGATCAAAGGGCTGGACAGTTTGTC
ATCACCTTTCCTCAGGCCTATCACGCAGGTTTTAATCACGGCTTCAATTTCAACGAGGCCGTCAACTTTGCTCCT
TCTGACTGGGAACCGTTTGGGCTGGCTGGCGTCGAGCGTCTACAAGCCTTTCGTCGACAGCCTTGCTTTTCTCAC
GATGAACTCCTTTGGACCGCGGCAGAAGGCAGCACGTCTCTAAGTCTGACGATACAAACGGCCAAATGGCTCGCC
CCGGCTTTGGAGCGCATTCGCAAACGCGAAGCTACGCAACGAGACGGCTTCATCACCAAGCACAAAGGCTCGTCT
TCTCACAAGTGCCGGTTTTCGGGCTCTGATGAGTCTGACTGTCCATTGACATTTCATGTCCAAGATGAAGATGTC
CAGGACGAGGATGAACAGTGTTGCAGTCATTGCAAGGCGTTTGCCTATTTATCCCGCTTCAAGTGCCATAAATCT
GGCAAGGTTATGTGCATTCTTCATGCTGGAAGCTATGCATGCTGTGAGCTGTCTGAGGAGCACCGCTTTCTCGGC
AAGAACCACTCTCTCTACTACCGCAAATCGGACGAGGCTGTTGAAGCAACATACAATCGGGTGTTTGAAAAGGCT
CGCACGCCGGAGATTTGGGAGGAAAAATATGCGAAAATGCTTGATGAAGAAGTAAAACCACCTCTAAAGACGCTT
CGCACAATGCTTCACGAGGGAGAGCGCATTCCTTGGGAGCTCCCATCATTGCCGATTTTGAAACAATTTGTCGAA
CGATGCAACGATTGGGTTGAAGAAGCGACAAACTATATTGTTCGGAAGCAGCAGAATCGCCGCAAGAATGAACGA
GTTTGGCAAAGCTCACTGCGAAAGTCGGTCAGCTTGGCTTCTCAGGATCAGAAGGAACGTGAATTGCGCAATGTC
TCTAATATCTATCGACTTCTCGGGGATGCGGAGAGAATCGGCTTTGAGTGTCCCGAAATTGGCCAGTTGCAAGAG
CGGGCCACTGCCATCAAGGAGTTCCAAGTCGGCGCTGCTCGAGCTCTGGAAAATACAACAAGTATAGGCACCCAA
GAGATTGAGAAGCTTATAGAAGAAGGACGTGGCTTCAACGTGGATACACCCGAGGTTGACCGCCTGTCAAGAGTT
CTTGATCAGATGCGCTGGAATGAAAAGGCCAATGAAAACCGCGGCGTCATTCTGACGCTCAAGGAAGTCCAGGAT
CTCATTGACGAGGGTAAGCGCTTGGAGATTCCAAGCTACAATGACTTTGTCAAGTACTACCGCGATCAACTGCAG
TTGGGCGAAGCGTGGGAGCGCAAGGTCAAGGAAATTATCGAAGCGGACATTGTTCACTATCCTCAGCTGGAAGCT
CTGTCAAAACAAGCTCAGGCCAATGCCCTTCCAGTGTCACCCGAGACTCTAGCCAAGGTGGACCAGATACTCCAC
AAACAGCGTGAAGCCCAGCGACAGATACACGACATTGTCGACCGTTGTCGAAATGCCGATTTGAGAAAACGGCCA
AAGTACTCTGAAGTTGTTGATATCTCCAAGAAGCTAGAAGATCTCAACTCCAAGCCCGAGGGCACGCTTGACCTG
GAGAATGAGAAGAAGCGACATGAAGACTGGATGCGCAAGGGAAAGCGCTTATTTGGCAAGTCGAATGCTCCACTT
CACATTCTCAAGAGCCATTTGGAATACGTTCTTGAGCGCAACGTGAGTTGCTTCGAAGTCGATCACGATACACCC
AGGCTGCCCGGCGAACCGAGTTCAAGAGACACGAGTCCCGAGCGAGCGGCGGGTACCGAATGGCAAGAGTCTCGG
CCAAGGCAGGTGTTTTGCATCTGCAGAAAGATTGAGCACGGAATGATGATTGAATGTGAGCTGTGCCATGAATGG
TACCACTACAAGTGTTTGAAGATTGCCCGCGGCAAGATTAAAGACGACGAGCTCTATACCTGTCCCATCTGTGAC
TGGCGCATGAAGATTCCTCGAGATGCAGCGCGACCGAAGCTTGAGGATTTGCTGTCATTGGCTGAAGAGATGCCA
GGGCTCCCCTTTCAGCCTGAAGAAGAGGAGGTTCTCAATGGCATCATATCCAATTCCCAGGCATTTCGAGATCAC
ATAGCGCGCTACTGCAACCCTCTCTTGTCTACCGAGGCTGAAGCCGACACACAACGATTTTACCTGCGCAAACTC
GAGGGAGCCGAAGTACTGCTGGCACACGAAACCAACTTTTTCCGTCAAGAGCTTCACAAGTGGTGTCCAGTTGCC
CCTCAGCCACCACCGATTCTGCAGGTGTCGCTCAGCACTCGCAAGCCTCGGCCGACAAAGCTTCAAAAGATGCTG
GCAGAGTATGGCGTGCAGAATCCTGACGACTTACCTGAGCACGCCAAGGGCAAGGCCAATAGTCTCCGGCGAAAG
GCTGCCAATGCAGAGGCGGCGGCAGCGGCGGCAGCAGCAGCAGCAGCCCAGTCATCTGGCTCGGGTGTCATACTA
CCCACGTCGAGCCATGGTTCTTATGCAGGGCCGACGTTTTACGCGCGCCCCATACAGTCAGCCATGGTTAATGTT
GATGTTTCAATGCACAGCCATCCATCAAAAGCTGGTCCGGACCATTCACGAGATCACTCAGAGGCAGACAGCGGA
GTTGATGACAGCAACATACATCCTGGCTTCCTAGGAGCCGGAGGACCACAGCTCGTTGTAGACAACTCAGTTTTG
ACGCTGGAGGAACGGCTGCTGCGGGGCCAGGAAGACGGGATCAATCTACAGACCGAGGCCGGCAAGAGTAAGGCT
CTCGAGATTCTCGGCAGAACCGAGGTGGGCAGGAAGCAGGCAGAAAAGATTTGGGGCTCAGATGTGTGGGGGTCG
TCGACTCGGCGCTCACTCAGTGACCAGGATGGATCCATGACGCCAGTTGAAATGAATGACTTGATGCACCACAAG
CAGGACGAAGGCAATGTGGAACAGATGTTCAAGGAAATGACGAACCAGGATGAAGACGAGGACCAGAAAAAGAAG
GAGAATACAAGTAATGGGCCCGTGACGGCCGAGTCGCTTGAGAGCGAGCGGAACGGGCTCGACGCCCTGCTGGAC
GGAGAGTAG
Transcript >OphauB2|1735
ATGGGGTCGGCTGCAGCTGTTCGCACTGCACCGGCGGCCAATGCAGGCAGTGGAAATGGGAGCTCGCGCAACTCA
CCAACCGCTACCGGCTCCACAAGCCAGCCATCTACAAGACCTCAGCGCAAGGTCAATACCAACGGCTATCATCCC
CCCAATACCCACTTGCCCTTGAGCGCCATGGTTAGCACTGGTCTCGATTTGACCTCGGTCGAGCGCCGTGGCCAG
CCTACTGCCATTCGTGAGCCCGTCAAGAAGGCAACGAGGCCTCATGGCATCACCGAGGCTCCAACTTACTCCCCC
ACTGAGGACGAATGGCGGGACCCGTTAGAATACATCAGAAAAATCTCTTCCGAGGCTTCAAAATATGGACTCTGC
AAAATTATTCCCCCAGACTCGTGGAACCCTGACTTTGCCATTGATACCGAGAAGTTTCATTTTCGGACGAGAAAG
CAGGAGCTAAACTCAGTAGAAGGACGGACCCGTGCCAATTTGACGTACCTCGATGGATTAGCCAAATTTCATAAA
CAGCACGGGAGCAACTTGCACCGACTTCCATATGTCGATAAGAAACCGCTCGATTTGTATCGTCTAAAAAAAGCC
GTCGAATCTCGTGGCGGATTTGAAAAGGTGTGCAAACAAAAAAAATGGGCAGAGATTGGTCGAGATTTGGGCTAT
AGCGGTAAAATAATGTCGTCGTTGTCTACGTCGCTCAAGAACTCTTATCAGAGATGGCTATGTCCCTACGAAGAG
TACCTGCGCCTTGCCAAGCCAGGTGTTCACCAGCAGCTGGAACAAGAATACGGAGGGCCTTTGACTCCGAGCCCG
GCTCAAACTCCGCTTAAGAGACATGATGTTCAAACACCATCCAGCGCTAAAGGAGACTCACCCGCCCGACAGGCA
TTGGATACCCTCCAAAACAGCTTTGAAAGTTTAAAAAAAGAAACGGACCGCGATAGTCCCATGACGGATGCCCCC
CCGGCCGTGACACCCACGGGTGGCTTCACTGCCATCAACTCAGGTGGCGGCTTTACTGCAGTAAATGTGGCACCA
AGCAGCGTGCCTCGCTCCATCAATGGCGACGGCCACGGCTCTACTCCCGATGCTAAGCGAGTCAACAGTCCAGGG
CCGTCGGCCAAAACCACTCCACTGAGACCAGCTGCAGCGTTGAAACGACAGCAAAGCTTTGGCAGTCTATCCGAT
TCAGCCAAGAAGGACGGCGATGGTGAAAAGGAGGATAATGAGAACAGCAGTCGCCGTAGCAAGCGCTTAAAGAAG
GACTCTGTTCCAACTGTGGCTGGATCACATATGACCATGTTCCGCCCATCCGTTCCACGTATTCCTCGCGACGAG
GCAGCCTTGAGTGGACATAAATGCGAGATTTGTGGACGGGGCGATGATGCAGGGTCTCTGCTCGTTTGCGAATCC
TGCGACCACTCGTACCACGGTCCTTGTCTTGATCCGCCACTCAAACGCAAGCCCGACGCTGAGTGGAACTGCCCT
CGTTGCCTTGTCGGCGATGGCCAATTTGGCTTCGAGGAGGGCGGCCTGTACTCTCTCAGACAATTCCAGCAAAAA
GCCAACGACTTTAAACAGGGCTATTTCGAGAGAAAAATGCCATATGACCATGCGCTCAACTGCCATCGCCCTGTC
ACGGAGCATGACGTTGAATCTGAATTTTGGCGCTTGGTGTCTGATTTGGAAGAAACAGTCGAAGTCGAGTACGGT
GCCGATATTCACTGCACGACGCACGGCTCTGGATTTCCAACGGTTGAGAGAAACCCCAAGAGCCCTTATTCTACA
GATCCCTGGAATCTTAATGTCCTGCCATTTCATACTGACAGCTTATTCCGACATATTAAGTCTGATATTTCGGGA
ATGACAGTGCCTTGGGTGTATGTAGGCATGATATTCTCAACGTTTTGTTGGCACAATGAGGACCACTATGCATAC
TCAGCCAACTATCAGCACTTTGGCGCCACCAAGACTTGGTACGGAATTCCGGGAGAAGATGCTGATAAATTCGAG
GCAGCCATGAAAGAAGCGCTCAAGAAGGCTGGCGTGCGCGTTTATGCTCTGGATCAAAGGGCTGGACAGTTTGTC
ATCACCTTTCCTCAGGCCTATCACGCAGGTTTTAATCACGGCTTCAATTTCAACGAGGCCGTCAACTTTGCTCCT
TCTGACTGGGAACCGTTTGGGCTGGCTGGCGTCGAGCGTCTACAAGCCTTTCGTCGACAGCCTTGCTTTTCTCAC
GATGAACTCCTTTGGACCGCGGCAGAAGGCAGCACGTCTCTAAGTCTGACGATACAAACGGCCAAATGGCTCGCC
CCGGCTTTGGAGCGCATTCGCAAACGCGAAGCTACGCAACGAGACGGCTTCATCACCAAGCACAAAGGCTCGTCT
TCTCACAAGTGCCGGTTTTCGGGCTCTGATGAGTCTGACTGTCCATTGACATTTCATGTCCAAGATGAAGATGTC
CAGGACGAGGATGAACAGTGTTGCAGTCATTGCAAGGCGTTTGCCTATTTATCCCGCTTCAAGTGCCATAAATCT
GGCAAGGTTATGTGCATTCTTCATGCTGGAAGCTATGCATGCTGTGAGCTGTCTGAGGAGCACCGCTTTCTCGGC
AAGAACCACTCTCTCTACTACCGCAAATCGGACGAGGCTGTTGAAGCAACATACAATCGGGTGTTTGAAAAGGCT
CGCACGCCGGAGATTTGGGAGGAAAAATATGCGAAAATGCTTGATGAAGAAGTAAAACCACCTCTAAAGACGCTT
CGCACAATGCTTCACGAGGGAGAGCGCATTCCTTGGGAGCTCCCATCATTGCCGATTTTGAAACAATTTGTCGAA
CGATGCAACGATTGGGTTGAAGAAGCGACAAACTATATTGTTCGGAAGCAGCAGAATCGCCGCAAGAATGAACGA
GTTTGGCAAAGCTCACTGCGAAAGTCGGTCAGCTTGGCTTCTCAGGATCAGAAGGAACGTGAATTGCGCAATGTC
TCTAATATCTATCGACTTCTCGGGGATGCGGAGAGAATCGGCTTTGAGTGTCCCGAAATTGGCCAGTTGCAAGAG
CGGGCCACTGCCATCAAGGAGTTCCAAGTCGGCGCTGCTCGAGCTCTGGAAAATACAACAAGTATAGGCACCCAA
GAGATTGAGAAGCTTATAGAAGAAGGACGTGGCTTCAACGTGGATACACCCGAGGTTGACCGCCTGTCAAGAGTT
CTTGATCAGATGCGCTGGAATGAAAAGGCCAATGAAAACCGCGGCGTCATTCTGACGCTCAAGGAAGTCCAGGAT
CTCATTGACGAGGGTAAGCGCTTGGAGATTCCAAGCTACAATGACTTTGTCAAGTACTACCGCGATCAACTGCAG
TTGGGCGAAGCGTGGGAGCGCAAGGTCAAGGAAATTATCGAAGCGGACATTGTTCACTATCCTCAGCTGGAAGCT
CTGTCAAAACAAGCTCAGGCCAATGCCCTTCCAGTGTCACCCGAGACTCTAGCCAAGGTGGACCAGATACTCCAC
AAACAGCGTGAAGCCCAGCGACAGATACACGACATTGTCGACCGTTGTCGAAATGCCGATTTGAGAAAACGGCCA
AAGTACTCTGAAGTTGTTGATATCTCCAAGAAGCTAGAAGATCTCAACTCCAAGCCCGAGGGCACGCTTGACCTG
GAGAATGAGAAGAAGCGACATGAAGACTGGATGCGCAAGGGAAAGCGCTTATTTGGCAAGTCGAATGCTCCACTT
CACATTCTCAAGAGCCATTTGGAATACGTTCTTGAGCGCAACGTGAGTTGCTTCGAAGTCGATCACGATACACCC
AGGCTGCCCGGCGAACCGAGTTCAAGAGACACGAGTCCCGAGCGAGCGGCGGGTACCGAATGGCAAGAGTCTCGG
CCAAGGCAGGTGTTTTGCATCTGCAGAAAGATTGAGCACGGAATGATGATTGAATGTGAGCTGTGCCATGAATGG
TACCACTACAAGTGTTTGAAGATTGCCCGCGGCAAGATTAAAGACGACGAGCTCTATACCTGTCCCATCTGTGAC
TGGCGCATGAAGATTCCTCGAGATGCAGCGCGACCGAAGCTTGAGGATTTGCTGTCATTGGCTGAAGAGATGCCA
GGGCTCCCCTTTCAGCCTGAAGAAGAGGAGGTTCTCAATGGCATCATATCCAATTCCCAGGCATTTCGAGATCAC
ATAGCGCGCTACTGCAACCCTCTCTTGTCTACCGAGGCTGAAGCCGACACACAACGATTTTACCTGCGCAAACTC
GAGGGAGCCGAAGTACTGCTGGCACACGAAACCAACTTTTTCCGTCAAGAGCTTCACAAGTGGTGTCCAGTTGCC
CCTCAGCCACCACCGATTCTGCAGGTGTCGCTCAGCACTCGCAAGCCTCGGCCGACAAAGCTTCAAAAGATGCTG
GCAGAGTATGGCGTGCAGAATCCTGACGACTTACCTGAGCACGCCAAGGGCAAGGCCAATAGTCTCCGGCGAAAG
GCTGCCAATGCAGAGGCGGCGGCAGCGGCGGCAGCAGCAGCAGCAGCCCAGTCATCTGGCTCGGGTGTCATACTA
CCCACGTCGAGCCATGGTTCTTATGCAGGGCCGACGTTTTACGCGCGCCCCATACAGTCAGCCATGGTTAATGTT
GATGTTTCAATGCACAGCCATCCATCAAAAGCTGGTCCGGACCATTCACGAGATCACTCAGAGGCAGACAGCGGA
GTTGATGACAGCAACATACATCCTGGCTTCCTAGGAGCCGGAGGACCACAGCTCGTTGTAGACAACTCAGTTTTG
ACGCTGGAGGAACGGCTGCTGCGGGGCCAGGAAGACGGGATCAATCTACAGACCGAGGCCGGCAAGAGTAAGGCT
CTCGAGATTCTCGGCAGAACCGAGGTGGGCAGGAAGCAGGCAGAAAAGATTTGGGGCTCAGATGTGTGGGGGTCG
TCGACTCGGCGCTCACTCAGTGACCAGGATGGATCCATGACGCCAGTTGAAATGAATGACTTGATGCACCACAAG
CAGGACGAAGGCAATGTGGAACAGATGTTCAAGGAAATGACGAACCAGGATGAAGACGAGGACCAGAAAAAGAAG
GAGAATACAAGTAATGGGCCCGTGACGGCCGAGTCGCTTGAGAGCGAGCGGAACGGGCTCGACGCCCTGCTGGAC
GGAGAGTAG
Gene >OphauB2|1735
ATGGGGTCGGCTGCAGCTGTTCGCACTGCACCGGCGGCCAATGCAGGCAGTGGAAATGGGAGCTCGCGCAACTCA
CCAACCGCTACCGGCTCCACAAGCCAGCCATCTACAAGACCTCAGCGCAAGGTCAATACCAACGGCTATCATCCC
CCCAATACCCACTTGCCCTTGAGCGCCATGGTTAGCACTGGTCTCGATTTGACCTCGGTCGAGCGCCGTGGCCAG
CCTACTGCCATTCGTGAGCCCGTCAAGAAGGCAACGAGGCCTCATGGCATCACCGAGGCTCCAACTTACTCCCCC
ACTGAGGACGAATGGCGGGACCCGTTAGAATACATCAGAAAAATCTCTTCCGAGGCTTCAAAATATGGACTCTGC
AAAATTATTCCCCCAGACTCGTGGAACCCTGACTTTGCCATTGATACCGAGGTACGCTTCGCATAGCAGACCAAT
ATTGTTTGGGCCTACCACCGCCTTTGTCCTTTGAGTCTCCAGTCTGGTCTCGACACGCGTCTTCTTGCTTACCAG
GATTACTGCAGAAGTTTCATTTTCGGACGAGAAAGCAGGAGCTAAACTCAGTAGAAGGACGTGGGTCTTGATTGC
CACATTCTCTTGCTAATTGAAGCCCCAAGCTGATGCTGCCCATGTCTAGGGACCCGTGCCAATTTGACGTACCTC
GATGGATTAGCCAAATTTCATAAACAGCACGGGAGCAACTTGCACCGACTTCCATATGTCGATAAGAAACCGCTC
GATTTGTATCGTCTAAAAAAAGCCGTCGAATCTCGTGGCGGATTTGAAAAGGTGTGCAAACAAAAAAAATGGGCA
GAGATTGGTCGAGATTTGGGCTATAGCGGTAAAATAATGTCGTCGTTGTCTACGTCGCTCAAGAACTCTTATCAG
AGATGGCTATGTCCCTACGAAGAGTACCTGCGCCTTGCCAAGCCAGGTGTTCACCAGCAGCTGGAACAAGAATAC
GGAGGGCCTTTGACTCCGAGCCCGGCTCAAACTCCGCTTAAGAGACATGATGTTCAAACACCATCCAGCGCTAAA
GGAGACTCACCCGCCCGACAGGCATTGGATACCCTCCAAAACAGCTTTGAAAGTTTAAAAAAAGAAACGGACCGC
GATAGTCCCATGACGGATGCCCCCCCGGCCGTGACACCCACGGGTGGCTTCACTGCCATCAACTCAGGTGGCGGC
TTTACTGCAGTAAATGTGGCACCAAGCAGCGTGCCTCGCTCCATCAATGGCGACGGCCACGGCTCTACTCCCGAT
GCTAAGCGAGTCAACAGTCCAGGGCCGTCGGCCAAAACCACTCCACTGAGACCAGCTGCAGCGTTGAAACGACAG
CAAAGCTTTGGCAGTCTATCCGATTCAGCCAAGAAGGACGGCGATGGTGAAAAGGAGGATAATGAGAACAGCAGT
CGCCGTAGCAAGCGCTTAAAGAAGGGTGCGTTGCTTCCGCAGCATTGCCAAGTGTGCATTTGCTGATATTTGACT
GACTGAAATTTTCTTTGCAGACTCTGTTCCAACTGTGGCTGGATCACATATGACCATGTTCCGCCCATCCGTTCC
ACGTATTCCTCGCGACGAGGCAGCCTTGAGTGGACATGTAAGAAGTTGAGAATTGAAGCGCAAAGACGAGGTGAC
TGACCTTTTTTATTTTCAGAAATGCGAGATTTGTGGACGGGGCGATGATGCAGGGTCTCTGCTCGTTTGCGAATC
CTGCGACCACTCGTACCACGGTCCTTGTCTTGATCCGCCACTCAAACGCAAGCCCGACGCTGAGTGGAACTGCCC
TCGTTGCCTTGTCGGCGATGGCCAATTTGGCTTCGAGGAGGGCGGCCTGTACTCTCTCAGACAATTCCAGCAAAA
AGCCAACGACTTTAAACAGGGCTATTTCGAGAGAAAAATGCCATATGACCATGCGCTCAACTGCCATCGCCCTGT
CACGGAGCATGACGTTGAATCTGAATTTTGGCGCTTGGTGTCTGATTTGGAAGAAACAGTCGAAGTCGAGTACGG
TGCCGATATTCACTGCACGACGCACGGCTCTGGATTTCCAACGGTTGAGAGAAACCCCAAGAGCCCTTATTCTAC
AGATCCCTGGAATCTTAATGTCCTGCCATTTCATACTGACAGCTTATTCCGACATATTAAGTCTGATATTTCGGG
AATGACAGTGCCTTGGGTGTATGTAGGCATGATATTCTCAACGTTTTGTTGGCACAATGAGGACCACTATGCATA
CTCAGCCAACTATCAGCACTTTGGCGCCACCAAGACTTGGTACGGAATTCCGGGAGAAGATGCTGATAAATTCGA
GGCAGCCATGAAAGAAGCGGTCCCCGAGCTTTTCGAGACACAACCAGATTTGTTGTTCCAACTTGTCACCTTACT
AACGCCGGAGCAGCTCAAGAAGGCTGGCGTGCGCGTTTATGCTCTGGATCAAAGGGCTGGACAGTTTGTCATCAC
CTTTCCTCAGGCCTATCACGCAGGTTTTAATCACGGCTTCAATTTCAACGAGGCCGTCAACTTTGCTCCTTCTGA
CTGGGAACCGTTTGGGCTGGCTGGCGTCGAGCGTCTACAAGCCTTTCGTCGACAGCCTTGCTTTTCTCACGATGA
ACTCCTTTGGACCGCGGCAGAAGGCAGCACGTCTCTAAGTCTGACGATACAAACGGCCAAATGGCTCGCCCCGGC
TTTGGAGCGCATTCGCAAACGCGAAGCTACGCAACGAGACGGCTTCATCACCAAGCACAAAGGCTCGTCTTCTCA
CAAGTGCCGGTTTTCGGGCTCTGATGAGTCTGACTGTCCATTGACATTTCATGTCCAAGATGAAGATGTCCAGGA
CGAGGATGAACAGTGTTGCAGTCATTGCAAGGCGTTTGCCTATTTATCCCGCTTCAAGTGCCATAAATCTGGCAA
GGTTATGTGCATTCTTCATGCTGGAAGCTATGCATGCTGTGAGCTGTCTGAGGAGCACCGCTTTCTCGGCAAGAA
CCACTCTCTCTACTACCGCAAATCGGACGAGGCTGTTGAAGCAACATACAATCGGGTGTTTGAAAAGGCTCGCAC
GCCGGAGATTTGGGAGGAAAAATATGCGAAAATGCTTGATGAAGAAGTAAAACCACCTCTAAAGACGCTTCGCAC
AATGCTTCACGAGGGAGAGCGCATTCCTTGGGAGCTCCCATCATTGCCGATTTTGAAACAATTTGTCGAACGATG
CAACGATTGGGTTGAAGAAGCGACAAACTATATTGTTCGGAAGCAGCAGAATCGCCGCAAGAATGAACGAGTTTG
GCAAAGCTCACTGCGAAAGTCGGTCAGCTTGGCTTCTCAGGATCAGAAGGAACGTGAATTGCGCAATGTCTCTAA
TATCTATCGACTTCTCGGGGATGCGGAGAGAATCGGCTTTGAGTGTCCCGAAATTGGCCAGTTGCAAGAGCGGGC
CACTGCCATCAAGGAGTTCCAAGTCGGCGCTGCTCGAGCTCTGGAAAATACAACAAGTATAGGCACCCAAGAGAT
TGAGAAGCTTATAGAAGAAGGACGTGGCTTCAACGTGGATACACCCGAGGTTGACCGCCTGTCAAGAGTTCTTGA
TCAGATGCGCTGGAATGAAAAGGCCAATGAAAACCGCGGCGTCATTCTGACGCTCAAGGAAGTCCAGGATCTCAT
TGACGAGGGTAAGCGCTTGGAGATTCCAAGCTACAATGACTTTGTCAAGTACTACCGCGATCAACTGCAGTTGGG
CGAAGCGTGGGAGCGCAAGGTCAAGGAAATTATCGAAGCGGACATTGTTCACTATCCTCAGCTGGAAGCTCTGTC
AAAACAAGCTCAGGCCAATGCCCTTCCAGTGTCACCCGAGACTCTAGCCAAGGTGGACCAGATACTCCACAAACA
GCGTGAAGCCCAGCGACAGATACACGACATTGTCGACCGTTGTCGAAATGCCGATTTGAGAAAACGGCCAAAGTA
CTCTGAAGTTGTTGATATCTCCAAGAAGCTAGAAGATCTCAACTCCAAGCCCGAGGGCACGCTTGACCTGGAGAA
TGAGAAGAAGCGACATGAAGACTGGATGCGCAAGGGAAAGCGCTTATTTGGCAAGTCGAATGCTCCACTTCACAT
TCTCAAGAGCCATTTGGAATACGTTCTTGAGCGCAACGTGAGTTGCTTCGAAGTCGATCACGATACACCCAGGCT
GCCCGGCGAACCGAGTTCAAGAGACACGAGTCCCGAGCGAGCGGCGGGTACCGAATGGCAAGAGTCTCGGCCAAG
GCAGGTGTTTTGCATCTGCAGAAAGATTGAGCACGGAATGATGATTGAATGTGAGCTGTGCCATGAATGGTGAGT
GGCTGACTGGCTCGCACAATGTTACAGAGCCACAGACTTCTGACTAGTAGCTATAGGTACCACTACAAGTGTTTG
AAGATTGCCCGCGGCAAGATTAAAGACGACGAGCTCTATACCTGTCCCATCTGTGACTGGCGCATGAAGATTCCT
CGAGATGCAGCGCGACCGAAGCTTGAGGATTTGCTGTCATTGGCTGAAGAGATGCCAGGGCTCCCCTTTCAGCCT
GAAGAAGAGGAGGTTCTCAATGGCATCATATCCAATTCCCAGGCATTTCGAGATCACATAGCGCGCTACTGCAAC
CCTCTCTTGTCTACCGAGGCTGAAGCCGACACACAACGATTTTACCTGCGCAAACTCGAGGGAGCCGAAGTACTG
CTGGCACACGAAACCAACTTTTTCCGTCAAGAGCTTCACAAGTGGTGTCCAGTTGCCCCTCAGCCACCACCGATT
CTGCAGGTGTCGCTCAGCACTCGCAAGCCTCGGCCGACAAAGCTTCAAAAGATGCTGGCAGAGTATGGCGTGCAG
AATCCTGACGACTTACCTGAGCACGCCAAGGGCAAGGCCAATAGTCTCCGGCGAAAGGCTGCCAATGCAGAGGCG
GCGGCAGCGGCGGCAGCAGCAGCAGCAGCCCAGTCATCTGGCTCGGGTGTCATACTACCCACGTCGAGCCATGGT
TCTTATGCAGGGCCGACGTTTTACGCGCGCCCCATACAGTCAGCCATGGTTAATGTTGATGTTTCAATGCACAGC
CATCCATCAAAAGCTGGTCCGGACCATTCACGAGATCACTCAGAGGCAGACAGCGGAGTTGATGACAGCAACATA
CATCCTGGCTTCCTAGGAGCCGGAGGACCACAGCTCGTTGTAGACAACTCAGTTTTGACGCTGGAGGAACGGCTG
CTGCGGGGCCAGGAAGACGGGATCAATCTACAGACCGAGGCCGGCAAGAGTAAGGCTCTCGAGATTCTCGGCAGA
ACCGAGGTGGGCAGGAAGCAGGCAGAAAAGATTTGGGGCTCAGATGTGTGGGGGTCGTCGACTCGGCGCTCACTC
AGTGACCAGGATGGATCCATGACGCCAGTTGAAATGAATGACTTGATGCACCACAAGCAGGACGAAGGCAATGTG
GAACAGATGTTCAAGGAAATGACGAACCAGGATGAAGACGAGGACCAGAAAAAGAAGGAGAATACAAGTAATGGG
CCCGTGACGGCCGAGTCGCTTGAGAGCGAGCGGAACGGGCTCGACGCCCTGCTGGACGGAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail