Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1733
Gene name
LocationContig_15:61941..63493
Strand+
Gene length (bp)1552
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11931 SF3a60_Prp9_C SF3a60/Prp9 C-terminal 7.4E-54 379 498
PF16837 SF3A3 Pre-mRNA-splicing factor SF3A3, of SF3a complex, Prp9 9.0E-17 127 168
PF12874 zf-met Zinc-finger of C2H2 type 4.6E-06 246 269
PF12108 SF3a60_bindingd Splicing factor SF3a60 binding domain 3.3E-07 74 99
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 5.6E-05 246 270

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59706|SAP61_SCHPO Pre-mRNA-splicing factor sap61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap61 PE=1 SV=1 2 498 4.0E-135
sp|Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens GN=SF3A3 PE=1 SV=1 2 498 3.0E-78
sp|Q9D554|SF3A3_MOUSE Splicing factor 3A subunit 3 OS=Mus musculus GN=Sf3a3 PE=1 SV=2 2 498 1.0E-76
sp|O46106|NOI_DROME Splicing factor 3A subunit 3 OS=Drosophila melanogaster GN=noi PE=1 SV=1 2 498 1.0E-73
sp|P19736|PRP9_YEAST Pre-mRNA-splicing factor PRP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP9 PE=1 SV=1 124 498 2.0E-53

GO

GO Term Description Terminal node
GO:0005681 spliceosomal complex Yes
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0006397 mRNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006396 RNA processing No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0090304 nucleic acid metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008380 RNA splicing No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0016071 mRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1733
MSILEKERFIHEDLERLEQGISDRVLDEYKHIRNNLKRDHEIAQLLDQIQQQSQQLVEIFDDASGQVASEIEQLQ
AGDPFAQFYSRLNDIRERHSRYSNEQAENLELRYKPRRGDGVTATTSVVDTLFTGEEAYGRFFDLNLCHQKFLNL
ANAKRLSYLQYLEDFDNFTSGHGGLKRTEKMNDEYLQYLAELANYLISFKKRTKPLENLDRILSEFDAEFAKAWE
KGEVEGWQSEPKPENTAEAIWCADCEKYFASQGTYNGHLSGRKHRRAAEKKKQEADDEAQNSEAKPEAPTLSTKQ
VMERAIAQREFRIKRLASSMSTERSDTRVNVERKQGMTERERQQELDILNNIEEMPTGGAEGAEDEDEDGDDKIY
NPLKLPLAWDGKPIPFWLYRLHGLGVEFHCEICGNFVYMGRRAFDKHFGEQRHIYGLKCLGITQVGLFRDITKID
EALKLWEKLQQEEKKNKLDDGSMVQMEDGEGNVMPEKVYLDLQKQGLL*
Coding >OphauB2|1733
ATGTCGATCCTCGAAAAGGAGCGCTTCATTCATGAAGACTTGGAACGCCTTGAGCAGGGCATCTCTGACCGCGTC
CTCGACGAGTACAAGCATATTCGTAACAACTTGAAACGAGACCATGAGATTGCCCAGCTGTTGGACCAGATACAA
CAGCAGTCGCAACAACTTGTCGAGATCTTTGACGATGCTTCAGGACAAGTGGCAAGCGAGATAGAACAATTACAA
GCTGGAGACCCGTTTGCGCAATTCTATAGTCGTCTCAATGATATCCGAGAGCGCCATAGTCGATATTCCAACGAA
CAGGCAGAAAATCTAGAACTGCGGTACAAACCGAGACGTGGGGATGGTGTAACAGCAACAACTTCAGTAGTCGAC
ACGCTCTTCACAGGCGAGGAAGCGTATGGACGTTTCTTCGACTTGAATCTTTGCCATCAAAAATTTCTCAACTTG
GCCAATGCTAAGCGGCTCAGTTACCTTCAGTATCTCGAAGACTTTGACAATTTTACCTCTGGACATGGTGGACTG
AAGCGAACGGAGAAGATGAATGATGAATATTTGCAGTATCTTGCTGAGTTGGCAAACTATCTCATTTCCTTCAAG
AAGCGCACAAAACCCTTGGAAAACTTGGACAGGATTCTATCCGAGTTTGATGCAGAATTTGCCAAGGCTTGGGAA
AAGGGCGAGGTTGAGGGCTGGCAGTCGGAGCCCAAGCCAGAAAATACAGCCGAAGCTATCTGGTGTGCCGACTGC
GAAAAATACTTTGCGAGTCAAGGCACCTACAATGGGCACCTTTCTGGCAGGAAACATAGACGCGCCGCCGAAAAG
AAAAAGCAGGAAGCTGATGATGAGGCGCAAAACTCAGAAGCCAAGCCTGAAGCTCCCACGTTGTCTACCAAGCAG
GTAATGGAAAGGGCGATTGCGCAACGTGAATTCCGCATCAAGCGACTTGCGAGCTCCATGAGTACAGAACGAAGC
GACACTCGTGTCAATGTGGAACGCAAACAGGGAATGACGGAAAGGGAGCGTCAGCAGGAACTGGACATTCTCAAT
AACATTGAGGAGATGCCAACAGGTGGTGCTGAAGGCGCCGAAGATGAAGATGAAGATGGTGACGACAAAATATAC
AACCCTCTCAAACTTCCACTCGCCTGGGATGGCAAACCCATTCCCTTTTGGCTGTACCGCCTTCATGGCCTCGGA
GTCGAATTTCACTGCGAGATTTGCGGCAACTTTGTATACATGGGGCGCAGAGCGTTTGACAAGCACTTTGGTGAA
CAGCGACACATCTATGGCCTCAAGTGCTTGGGTATCACCCAAGTGGGCTTGTTCCGCGACATTACCAAGATTGAC
GAGGCACTCAAGCTTTGGGAAAAGCTGCAGCAAGAAGAGAAGAAGAACAAGCTTGATGACGGTAGCATGGTGCAG
ATGGAAGACGGCGAAGGAAACGTGATGCCTGAAAAAGTCTACCTGGATCTACAGAAGCAAGGCTTGCTGTAA
Transcript >OphauB2|1733
ATGTCGATCCTCGAAAAGGAGCGCTTCATTCATGAAGACTTGGAACGCCTTGAGCAGGGCATCTCTGACCGCGTC
CTCGACGAGTACAAGCATATTCGTAACAACTTGAAACGAGACCATGAGATTGCCCAGCTGTTGGACCAGATACAA
CAGCAGTCGCAACAACTTGTCGAGATCTTTGACGATGCTTCAGGACAAGTGGCAAGCGAGATAGAACAATTACAA
GCTGGAGACCCGTTTGCGCAATTCTATAGTCGTCTCAATGATATCCGAGAGCGCCATAGTCGATATTCCAACGAA
CAGGCAGAAAATCTAGAACTGCGGTACAAACCGAGACGTGGGGATGGTGTAACAGCAACAACTTCAGTAGTCGAC
ACGCTCTTCACAGGCGAGGAAGCGTATGGACGTTTCTTCGACTTGAATCTTTGCCATCAAAAATTTCTCAACTTG
GCCAATGCTAAGCGGCTCAGTTACCTTCAGTATCTCGAAGACTTTGACAATTTTACCTCTGGACATGGTGGACTG
AAGCGAACGGAGAAGATGAATGATGAATATTTGCAGTATCTTGCTGAGTTGGCAAACTATCTCATTTCCTTCAAG
AAGCGCACAAAACCCTTGGAAAACTTGGACAGGATTCTATCCGAGTTTGATGCAGAATTTGCCAAGGCTTGGGAA
AAGGGCGAGGTTGAGGGCTGGCAGTCGGAGCCCAAGCCAGAAAATACAGCCGAAGCTATCTGGTGTGCCGACTGC
GAAAAATACTTTGCGAGTCAAGGCACCTACAATGGGCACCTTTCTGGCAGGAAACATAGACGCGCCGCCGAAAAG
AAAAAGCAGGAAGCTGATGATGAGGCGCAAAACTCAGAAGCCAAGCCTGAAGCTCCCACGTTGTCTACCAAGCAG
GTAATGGAAAGGGCGATTGCGCAACGTGAATTCCGCATCAAGCGACTTGCGAGCTCCATGAGTACAGAACGAAGC
GACACTCGTGTCAATGTGGAACGCAAACAGGGAATGACGGAAAGGGAGCGTCAGCAGGAACTGGACATTCTCAAT
AACATTGAGGAGATGCCAACAGGTGGTGCTGAAGGCGCCGAAGATGAAGATGAAGATGGTGACGACAAAATATAC
AACCCTCTCAAACTTCCACTCGCCTGGGATGGCAAACCCATTCCCTTTTGGCTGTACCGCCTTCATGGCCTCGGA
GTCGAATTTCACTGCGAGATTTGCGGCAACTTTGTATACATGGGGCGCAGAGCGTTTGACAAGCACTTTGGTGAA
CAGCGACACATCTATGGCCTCAAGTGCTTGGGTATCACCCAAGTGGGCTTGTTCCGCGACATTACCAAGATTGAC
GAGGCACTCAAGCTTTGGGAAAAGCTGCAGCAAGAAGAGAAGAAGAACAAGCTTGATGACGGTAGCATGGTGCAG
ATGGAAGACGGCGAAGGAAACGTGATGCCTGAAAAAGTCTACCTGGATCTACAGAAGCAAGGCTTGCTGTAA
Gene >OphauB2|1733
ATGTCGATCCTCGAAAAGGAGCGCTTCATTCATGAAGACTTGGAACGCCTTGAGCAGGGCATCTCTGACCGCGTC
CTCGACGAGTACAAGCATGTAAGATGCATATAGCTCCTCATCAGCTTGTTTTTTGTCGGACTGACGCGCCCAGAT
TCGTAACAACTTGAAACGAGACCATGAGATTGCCCAGCTGTTGGACCAGATACAACAGCAGTCGCAACAACTTGT
CGAGATCTTTGACGATGCTTCAGGACAAGTGGCAAGCGAGATAGAACAATTACAAGCTGGAGACCCGTTTGCGCA
ATTCTATAGTCGTCTCAATGATATCCGAGAGCGCCATAGTCGATATTCCAACGAACAGGCAGAAAATCTAGAACT
GCGGTACAAACCGAGACGTGGGGATGGTGTAACAGCAACAACTTCAGTAGTCGACACGCTCTTCACAGGCGAGGA
AGCGTATGGACGTTTCTTCGACTTGAATCTTTGCCATCAAAAATTTCTCAACTTGGCCAATGCTAAGCGGCTCAG
TTACCTTCAGTATCTCGAAGACTTTGACAATTTTACCTCTGGACATGGTGGACTGAAGCGAACGGAGAAGATGAA
TGATGAATATTTGCAGTATCTTGCTGAGTTGGCAAACTATCTCATTTCCTTCAAGAAGCGCACAAAACCCTTGGA
AAACTTGGACAGGATTCTATCCGAGTTTGATGCAGAATTTGCCAAGGCTTGGGAAAAGGGCGAGGTTGAGGGCTG
GCAGTCGGAGCCCAAGCCAGAAAATACAGCCGAAGCTATCTGGTGTGCCGACTGCGAAAAATACTTTGCGAGTCA
AGGCACCTACAATGGGCACCTTTCTGGCAGGAAACATAGACGCGCCGCCGAAAAGAAAAAGCAGGAAGCTGATGA
TGAGGCGCAAAACTCAGAAGCCAAGCCTGAAGCTCCCACGTTGTCTACCAAGCAGGTAATGGAAAGGGCGATTGC
GCAACGTGAATTCCGCATCAAGCGACTTGCGAGCTCCATGAGTACAGAACGAAGCGACACTCGTGTCAATGTGGA
ACGCAAACAGGGAATGACGGAAAGGGAGCGTCAGCAGGAACTGGACATTCTCAATAACATTGAGGAGATGCCAAC
AGGTGGTGCTGAAGGCGCCGAAGATGAAGATGAAGATGGTGACGACAAAATATACAACCCTCTCAAACTTCCACT
CGCCTGGGATGGCAAACCCATTCCCTTTTGGCTGTACCGCCTTCATGGCCTCGGAGTCGAATTTCACTGCGAGAT
TTGCGGCAACTTTGTATACATGGGGCGCAGAGCGTTTGACAAGCACTTTGGTGAACAGCGACACATCTATGGCCT
CAAGTGCTTGGGTATCACCCAAGTGGGCTTGTTCCGCGACATTACCAAGATTGACGAGGCACTCAAGCTTTGGGA
AAAGCTGCAGCAAGAAGAGAAGAAGAACAAGCTTGATGACGGTAGCATGGTGCAGATGGAAGACGGCGAAGGAAA
CGTGATGCCTGAAAAAGTCTACCTGGATCTACAGAAGCAAGGCTTGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail