Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1729
Gene name
LocationContig_15:51562..53300
Strand+
Gene length (bp)1738
Transcript length (bp)1596
Coding sequence length (bp)1596
Protein length (aa) 532

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39952|OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXA1 PE=1 SV=1 137 412 6.0E-23
sp|O13375|OXA1_KAZSE Mitochondrial inner membrane protein OXA1 OS=Kazachstania servazzii GN=OXA1 PE=3 SV=1 125 430 7.0E-22
sp|Q15070|OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens GN=OXA1L PE=1 SV=3 129 404 6.0E-15
sp|Q8BGA9|OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus GN=Oxa1l PE=1 SV=1 184 421 2.0E-14
sp|Q42191|OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana GN=OXA1 PE=2 SV=2 186 405 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39952|OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXA1 PE=1 SV=1 137 412 6.0E-23
sp|O13375|OXA1_KAZSE Mitochondrial inner membrane protein OXA1 OS=Kazachstania servazzii GN=OXA1 PE=3 SV=1 125 430 7.0E-22
sp|Q15070|OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens GN=OXA1L PE=1 SV=3 129 404 6.0E-15
sp|Q8BGA9|OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus GN=Oxa1l PE=1 SV=1 184 421 2.0E-14
sp|Q42191|OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana GN=OXA1 PE=2 SV=2 186 405 1.0E-12
sp|Q3SYV3|OXA1L_BOVIN Mitochondrial inner membrane protein OXA1L OS=Bos taurus GN=OXA1L PE=2 SV=1 186 387 4.0E-12
sp|O14300|OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa101 PE=2 SV=1 179 420 2.0E-10
sp|Q9SKD3|OXA1L_ARATH Mitochondrial inner membrane protein OXA1-like OS=Arabidopsis thaliana GN=OXA1L PE=2 SV=1 186 405 1.0E-09
sp|O43092|OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa102 PE=2 SV=2 181 336 4.0E-08
sp|Q4UNK8|YIDC_XANC8 Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=yidC PE=3 SV=1 192 372 7.0E-06
sp|Q8P338|YIDC_XANCP Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=yidC PE=3 SV=1 192 372 7.0E-06
sp|Q8PEH7|YIDC_XANAC Membrane protein insertase YidC OS=Xanthomonas axonopodis pv. citri (strain 306) GN=yidC PE=3 SV=1 192 372 7.0E-06
sp|Q3BLZ7|YIDC_XANC5 Membrane protein insertase YidC OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=yidC PE=3 SV=1 192 372 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 199 221 22
2 279 301 22
3 329 346 17
4 359 376 17
5 381 403 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1729
MLPSRGLTSSLPSSAARLRLQRLPRRNLSSLSTRLPRNDRQTSSALGALGGGGASGPTVASLLSMARHGHGVSPL
LGSVAAPSARNFSLWPSSGGSRGSGNSPAPPSQTPSGFVAEPVEPMDPVEPLNPVDAQAASTSTMPEVSATEFDM
GALNDAFQSSSALDILNMPERLGYLKAIGLDFGWGPTSVMQWALEHVHIMTGYSWTVSIFITAVIFRVLMFYPQM
RSARVAEKTRRLSKDPRSIKAVADFQNLRYDQKDTEAVMRKRLIDNMLRREYGLRLVDLLWTVIPVPLAFGFFRI
VNNMADVPVPALETGGFLWFTDLTAYDPYYILPIVNIAIAASTFYVSPTSMEQFKDAKPIAIAGFGILAVFLTSW
LNNAVNLMGIALGATNVIALCILRIPWVRKKAGMSPINDTPENEPPPPPPQTASITDRPPVPTGPVATPRPRDTP
PSPKYQPPRAPTGFRERITKELNDARHGFSKKVSNLTGSLDSSTQSEDKSETKRKENLRRIEELRHLRALEDFER
KYKNKR*
Coding >OphauB2|1729
ATGCTTCCCAGCAGAGGTCTCACGAGCTCTTTGCCCTCATCGGCAGCGAGATTGCGTCTCCAACGACTGCCAAGG
AGGAATCTAAGCTCTCTATCTACCAGACTACCACGCAATGATAGGCAGACAAGCTCTGCACTTGGCGCCCTCGGC
GGCGGCGGCGCTTCAGGCCCGACAGTAGCCTCTCTACTGAGCATGGCTCGCCATGGCCACGGTGTGAGCCCGCTC
CTCGGATCCGTAGCAGCACCGTCGGCGCGCAACTTTTCGCTCTGGCCTTCTTCTGGCGGGTCAAGAGGTAGCGGC
AATTCACCTGCGCCCCCCAGCCAAACTCCTTCAGGTTTCGTAGCCGAACCTGTCGAGCCCATGGATCCTGTTGAG
CCTTTGAACCCTGTCGATGCCCAAGCGGCCTCTACGTCTACTATGCCAGAGGTTTCAGCGACTGAATTTGACATG
GGTGCCCTCAACGACGCCTTCCAGAGCAGCAGTGCCCTAGACATACTCAACATGCCCGAAAGACTGGGCTACCTG
AAAGCCATTGGACTCGACTTCGGCTGGGGTCCCACCTCGGTCATGCAATGGGCGCTTGAGCACGTGCACATCATG
ACGGGCTATAGCTGGACCGTGAGCATCTTCATCACGGCAGTCATATTCCGAGTCCTTATGTTTTATCCGCAAATG
AGATCAGCCCGCGTCGCAGAAAAGACTAGACGCTTGTCCAAGGACCCTCGGAGTATAAAAGCCGTGGCCGACTTC
CAGAACCTGAGATACGACCAGAAGGATACGGAAGCCGTAATGCGCAAACGACTTATTGACAACATGTTGCGTCGC
GAATACGGCCTCAGACTTGTGGACCTTCTTTGGACCGTGATTCCAGTTCCCCTTGCCTTTGGCTTCTTCCGTATA
GTCAACAACATGGCGGATGTTCCCGTGCCCGCTCTCGAGACTGGTGGTTTCCTATGGTTTACCGACTTGACGGCC
TACGATCCCTATTACATACTTCCTATTGTCAACATAGCCATTGCGGCGAGTACCTTCTACGTGAGCCCTACTAGC
ATGGAGCAGTTTAAGGACGCCAAGCCAATCGCCATTGCGGGCTTTGGTATCTTGGCTGTCTTTCTAACCTCATGG
CTCAATAATGCCGTCAATCTCATGGGCATCGCCCTTGGCGCCACCAACGTGATTGCCCTCTGCATCCTTCGCATC
CCCTGGGTCCGCAAAAAGGCTGGCATGTCGCCCATCAATGACACCCCAGAGAATGAGCCCCCTCCCCCTCCTCCC
CAAACAGCCTCCATCACCGACCGCCCCCCTGTCCCAACAGGCCCCGTGGCCACGCCTCGCCCTCGAGACACTCCC
CCCTCCCCCAAGTATCAGCCTCCGCGCGCGCCCACGGGCTTCCGCGAACGCATCACCAAAGAACTCAATGACGCC
AGGCATGGCTTCTCGAAAAAGGTCTCAAACTTGACCGGCTCCCTCGACAGCAGCACCCAAAGTGAAGACAAGTCA
GAAACAAAACGCAAGGAAAATCTGCGTCGCATCGAGGAGCTGCGCCATCTTAGAGCTCTTGAAGATTTTGAAAGA
AAGTACAAGAATAAGCGGTAG
Transcript >OphauB2|1729
ATGCTTCCCAGCAGAGGTCTCACGAGCTCTTTGCCCTCATCGGCAGCGAGATTGCGTCTCCAACGACTGCCAAGG
AGGAATCTAAGCTCTCTATCTACCAGACTACCACGCAATGATAGGCAGACAAGCTCTGCACTTGGCGCCCTCGGC
GGCGGCGGCGCTTCAGGCCCGACAGTAGCCTCTCTACTGAGCATGGCTCGCCATGGCCACGGTGTGAGCCCGCTC
CTCGGATCCGTAGCAGCACCGTCGGCGCGCAACTTTTCGCTCTGGCCTTCTTCTGGCGGGTCAAGAGGTAGCGGC
AATTCACCTGCGCCCCCCAGCCAAACTCCTTCAGGTTTCGTAGCCGAACCTGTCGAGCCCATGGATCCTGTTGAG
CCTTTGAACCCTGTCGATGCCCAAGCGGCCTCTACGTCTACTATGCCAGAGGTTTCAGCGACTGAATTTGACATG
GGTGCCCTCAACGACGCCTTCCAGAGCAGCAGTGCCCTAGACATACTCAACATGCCCGAAAGACTGGGCTACCTG
AAAGCCATTGGACTCGACTTCGGCTGGGGTCCCACCTCGGTCATGCAATGGGCGCTTGAGCACGTGCACATCATG
ACGGGCTATAGCTGGACCGTGAGCATCTTCATCACGGCAGTCATATTCCGAGTCCTTATGTTTTATCCGCAAATG
AGATCAGCCCGCGTCGCAGAAAAGACTAGACGCTTGTCCAAGGACCCTCGGAGTATAAAAGCCGTGGCCGACTTC
CAGAACCTGAGATACGACCAGAAGGATACGGAAGCCGTAATGCGCAAACGACTTATTGACAACATGTTGCGTCGC
GAATACGGCCTCAGACTTGTGGACCTTCTTTGGACCGTGATTCCAGTTCCCCTTGCCTTTGGCTTCTTCCGTATA
GTCAACAACATGGCGGATGTTCCCGTGCCCGCTCTCGAGACTGGTGGTTTCCTATGGTTTACCGACTTGACGGCC
TACGATCCCTATTACATACTTCCTATTGTCAACATAGCCATTGCGGCGAGTACCTTCTACGTGAGCCCTACTAGC
ATGGAGCAGTTTAAGGACGCCAAGCCAATCGCCATTGCGGGCTTTGGTATCTTGGCTGTCTTTCTAACCTCATGG
CTCAATAATGCCGTCAATCTCATGGGCATCGCCCTTGGCGCCACCAACGTGATTGCCCTCTGCATCCTTCGCATC
CCCTGGGTCCGCAAAAAGGCTGGCATGTCGCCCATCAATGACACCCCAGAGAATGAGCCCCCTCCCCCTCCTCCC
CAAACAGCCTCCATCACCGACCGCCCCCCTGTCCCAACAGGCCCCGTGGCCACGCCTCGCCCTCGAGACACTCCC
CCCTCCCCCAAGTATCAGCCTCCGCGCGCGCCCACGGGCTTCCGCGAACGCATCACCAAAGAACTCAATGACGCC
AGGCATGGCTTCTCGAAAAAGGTCTCAAACTTGACCGGCTCCCTCGACAGCAGCACCCAAAGTGAAGACAAGTCA
GAAACAAAACGCAAGGAAAATCTGCGTCGCATCGAGGAGCTGCGCCATCTTAGAGCTCTTGAAGATTTTGAAAGA
AAGTACAAGAATAAGCGGTAG
Gene >OphauB2|1729
ATGCTTCCCAGCAGAGGTCTCACGAGCTCTTTGCCCTCATCGGCAGCGAGATTGCGTCTCCAACGACTGCCAAGG
GTTGGTAAATTCTCGACTCCTTTGTCCCAAGGTCCACATTAGACAGCATGGCGCCCACTGACTAGGCCTTGGACG
TGACAGAGGAATCTAAGCTCTCTATCTACCAGACTACCACGCAATGATAGGCAGACAAGCTCTGCACTTGGCGCC
CTCGGCGGCGGCGGCGCTTCAGGCCCGACAGTAGCCTCTCTACTGAGCATGGCTCGCCATGGCCACGGTGTGAGC
CCGCTCCTCGGATCCGTAGCAGCACCGTCGGCGCGCAACTTTTCGCTCTGGCCTTCTTCTGGCGGGTCAAGAGGT
AGCGGCAATTCACCTGCGCCCCCCAGCCAAACTCCTTCAGGTTTCGTAGCCGAACCTGTCGAGCCCATGGATCCT
GTTGAGCCTTTGAACCCTGTCGATGCCCAAGCGGCCTCTACGTCTACTATGCCAGAGGTTTCAGCGACTGAATTT
GACATGGGTGCCCTCAACGACGCCTTCCAGAGCAGCAGTGCCCTAGACATACTCAACATGCCCGAAAGACTGGGC
TACCTGAAAGCCATTGGACTCGACTTCGGCTGGGGTCCCACCTCGGTCATGCAATGGGCGCTTGAGCACGTGCAC
ATCATGACGGGCTATAGCTGGACCGTGAGCATCTTCATCACGGCAGTCATATTCCGAGTCCTTATGTTTTATCCG
CAAATGAGATCAGCCCGCGTCGCAGAAAAGACTAGACGCTTGTCCAAGGACCCTCGGAGTATAAAAGCCGTGGCC
GACTTCCAGAACCTGAGATACGACCAGAAGGATACGGAAGCCGTAATGCGCAAACGACTTATTGACAACATGTTG
CGTCGCGAATACGGCCTCAGACTTGTGGACCTTCTTTGGACCGTGATTCCAGTTCCCCTTGCCTTTGGCTTCTTC
CGTATAGTCAACAACATGGCGGATGTTCCCGTGCCCGCTCTCGAGACTGGTGGTTTCCTATGGTTTACCGACTTG
ACGGCCTACGATCCCTATTACATACTTCCTATTGTCAACATAGCCATTGCGGCGAGTACCTTCTACGTATGTCGA
GCCTCGTCCCCTCTTCTCCAGAACCCTTGACTTACTCCACGTGTGCCTACAGGTGAGCCCTACTAGCATGGAGCA
GTTTAAGGACGCCAAGCCAATCGCCATTGCGGGCTTTGGTATCTTGGCTGTCTTTCTAACCTCATGGCTCAATAA
TGCCGTCAATCTCATGGGCATCGCCCTTGGCGCCACCAACGTGATTGCCCTCTGCATCCTTCGCATCCCCTGGGT
CCGCAAAAAGGCTGGCATGTCGCCCATCAATGACACCCCAGAGAATGAGCCCCCTCCCCCTCCTCCCCAAACAGC
CTCCATCACCGACCGCCCCCCTGTCCCAACAGGCCCCGTGGCCACGCCTCGCCCTCGAGACACTCCCCCCTCCCC
CAAGTATCAGCCTCCGCGCGCGCCCACGGGCTTCCGCGAACGCATCACCAAAGAACTCAATGACGCCAGGCATGG
CTTCTCGAAAAAGGTCTCAAACTTGACCGGCTCCCTCGACAGCAGCACCCAAAGTGAAGACAAGTCAGAAACAAA
ACGCAAGGAAAATCTGCGTCGCATCGAGGAGCTGCGCCATCTTAGAGCTCTTGAAGATTTTGAAAGAAAGTACAA
GAATAAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail