Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1727
Gene name
LocationContig_15:48883..50259
Strand-
Gene length (bp)1376
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08059 SEP SEP domain 1.3E-24 217 290
PF00789 UBX UBX domain 2.1E-06 335 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C8Q0|UBX1_EMENI UBX domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubx1 PE=3 SV=1 6 414 8.0E-71
sp|Q9UT81|UBX3_SCHPO UBX domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx3 PE=1 SV=1 8 405 5.0E-38
sp|Q5RBG3|NSF1C_PONAB NSFL1 cofactor p47 OS=Pongo abelii GN=NSFL1C PE=2 SV=1 8 401 4.0E-34
sp|Q9UNZ2|NSF1C_HUMAN NSFL1 cofactor p47 OS=Homo sapiens GN=NSFL1C PE=1 SV=2 8 401 4.0E-34
sp|Q3SZC4|NSF1C_BOVIN NSFL1 cofactor p47 OS=Bos taurus GN=NSFL1C PE=2 SV=1 8 401 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C8Q0|UBX1_EMENI UBX domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubx1 PE=3 SV=1 6 414 8.0E-71
sp|Q9UT81|UBX3_SCHPO UBX domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx3 PE=1 SV=1 8 405 5.0E-38
sp|Q5RBG3|NSF1C_PONAB NSFL1 cofactor p47 OS=Pongo abelii GN=NSFL1C PE=2 SV=1 8 401 4.0E-34
sp|Q9UNZ2|NSF1C_HUMAN NSFL1 cofactor p47 OS=Homo sapiens GN=NSFL1C PE=1 SV=2 8 401 4.0E-34
sp|Q3SZC4|NSF1C_BOVIN NSFL1 cofactor p47 OS=Bos taurus GN=NSFL1C PE=2 SV=1 8 401 1.0E-33
sp|O35987|NSF1C_RAT NSFL1 cofactor p47 OS=Rattus norvegicus GN=Nsfl1c PE=1 SV=1 7 401 4.0E-33
sp|Q9CZ44|NSF1C_MOUSE NSFL1 cofactor p47 OS=Mus musculus GN=Nsfl1c PE=1 SV=1 7 401 4.0E-33
sp|Q5ZK10|NSF1C_CHICK NSFL1 cofactor p47 OS=Gallus gallus GN=NSFL1C PE=2 SV=1 8 401 5.0E-33
sp|P34223|UBX1_YEAST UBX domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHP1 PE=1 SV=1 101 401 6.0E-31
sp|Q5ZLK2|UBX2B_CHICK UBX domain-containing protein 2B OS=Gallus gallus GN=UBXN2B PE=2 SV=1 73 401 1.0E-30
sp|Q14CS0|UBX2B_HUMAN UBX domain-containing protein 2B OS=Homo sapiens GN=UBXN2B PE=1 SV=1 135 401 7.0E-29
sp|Q8RWU7|PUX4_ARATH Plant UBX domain-containing protein 4 OS=Arabidopsis thaliana GN=PUX4 PE=1 SV=1 131 401 2.0E-27
sp|Q0KL01|UBX2B_MOUSE UBX domain-containing protein 2B OS=Mus musculus GN=Ubxn2b PE=1 SV=2 130 401 3.0E-27
sp|P0C627|UBX2B_RAT UBX domain-containing protein 2B OS=Rattus norvegicus GN=Ubxn2b PE=1 SV=1 130 401 4.0E-27
sp|Q9SUG6|PUX3_ARATH Plant UBX domain-containing protein 3 OS=Arabidopsis thaliana GN=PUX3 PE=1 SV=1 131 401 4.0E-27
sp|Q0P3R5|UBX2B_XENLA UBX domain-containing protein 2B OS=Xenopus laevis GN=ubxn2b PE=2 SV=1 153 401 5.0E-25
sp|Q54BQ5|NSF1C_DICDI NSFL1 cofactor p47 homolog OS=Dictyostelium discoideum GN=nsfl1c PE=3 SV=1 27 393 2.0E-24
sp|Q7Y175|PUX5_ARATH Plant UBX domain-containing protein 5 OS=Arabidopsis thaliana GN=PUX5 PE=1 SV=1 7 393 6.0E-21
sp|Q99KJ0|UBX2A_MOUSE UBX domain-containing protein 2A OS=Mus musculus GN=Ubxn2a PE=1 SV=1 217 401 4.0E-13
sp|P68543|UBX2A_HUMAN UBX domain-containing protein 2A OS=Homo sapiens GN=UBXN2A PE=2 SV=1 217 401 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3301
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3176
Ophiocordyceps australis map64 (Brazil) OphauB2|1727 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03104
Ophiocordyceps camponoti-rufipedis Ophun1|3799
Ophiocordyceps kimflemingae Ophio5|8109
Ophiocordyceps subramaniannii Hirsu2|6083

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1727
MSEAPPEDKQKLVEQVCETCQVPEQIATHYLEAYSWDGEAAIGGFMADNFDAAEQATDEAAEPPYTGPRTLDGRP
APAESRQSPAARSQKQSLAKKKGVATLSSLAQASNVDDDDDMSENEDNKENRGNLFAGGEKSGLAVQDPSKEGGS
RSLINDIIAKAKSNSSLTEGPEAGPSNSSRFQGTGMTLGGDGQESRAIPDTSSLAHGTDAPVQERVLHIWENGFS
IDDGELRRYDDPANQADLEMIRQERAPLHLMNVQYDQPVKVRVLDHDTDYVAPPKKQTRFMGSGQRLGSPVPGAG
SSTAVADSAPRTTSAPAPGSAASSAFTGPTIDESQPIVTIRIQLPDGRRVPVRFNTSHTVGDMYKVLQDAHMELL
SSRPWILATTFPNKEHTDKSLALANAPEFKKGGTAVVKWTN*
Coding >OphauB2|1727
ATGAGCGAAGCACCGCCTGAAGACAAGCAGAAGCTTGTGGAGCAAGTCTGCGAGACGTGCCAGGTACCCGAGCAA
ATTGCGACGCACTATCTCGAAGCCTATAGCTGGGATGGTGAAGCTGCCATTGGAGGCTTCATGGCTGACAACTTT
GATGCTGCAGAGCAGGCTACTGATGAAGCTGCTGAGCCGCCATACACTGGCCCGCGCACTCTAGACGGCAGACCT
GCGCCCGCAGAGTCCCGACAGAGCCCTGCTGCTCGCTCACAAAAGCAATCGCTTGCCAAGAAGAAAGGTGTCGCC
ACCCTGAGCTCCCTTGCTCAGGCTTCAAATGTCGACGATGACGATGACATGTCAGAAAACGAGGATAACAAGGAA
AACCGAGGCAATCTCTTTGCCGGCGGAGAAAAGTCTGGGCTTGCGGTTCAGGATCCGAGCAAGGAGGGCGGATCA
CGAAGCCTCATCAACGATATCATTGCCAAGGCCAAATCCAACTCTTCTCTCACTGAAGGGCCAGAAGCTGGCCCT
TCTAACTCGTCTCGCTTCCAGGGTACGGGAATGACATTGGGTGGAGATGGTCAGGAAAGCCGTGCCATTCCAGAT
ACCTCGAGTCTGGCTCATGGAACAGATGCACCGGTACAGGAACGAGTGCTTCACATTTGGGAAAATGGATTCAGC
ATAGACGACGGCGAGCTACGGCGGTACGATGACCCCGCCAACCAAGCGGATCTAGAAATGATTCGCCAGGAACGA
GCTCCGCTGCACTTGATGAATGTGCAGTACGATCAACCCGTCAAAGTGCGGGTTCTTGACCACGACACGGATTAC
GTTGCACCGCCCAAAAAACAGACCCGTTTCATGGGGAGTGGACAGCGCCTCGGTAGTCCGGTTCCCGGGGCCGGC
TCTTCAACAGCCGTAGCTGATTCAGCGCCAAGGACGACGTCGGCTCCTGCACCAGGGAGTGCGGCATCGTCTGCC
TTTACAGGACCGACTATTGACGAGTCTCAACCAATTGTCACGATTCGTATTCAATTGCCAGATGGAAGACGAGTG
CCTGTACGATTCAACACGTCTCACACAGTCGGTGACATGTACAAGGTGCTGCAGGACGCACACATGGAATTGCTC
AGCTCACGGCCTTGGATCTTGGCGACCACATTTCCCAACAAGGAGCACACGGATAAAAGCCTAGCCTTGGCCAAC
GCGCCCGAGTTTAAGAAGGGAGGCACGGCAGTGGTCAAATGGACAAACTAG
Transcript >OphauB2|1727
ATGAGCGAAGCACCGCCTGAAGACAAGCAGAAGCTTGTGGAGCAAGTCTGCGAGACGTGCCAGGTACCCGAGCAA
ATTGCGACGCACTATCTCGAAGCCTATAGCTGGGATGGTGAAGCTGCCATTGGAGGCTTCATGGCTGACAACTTT
GATGCTGCAGAGCAGGCTACTGATGAAGCTGCTGAGCCGCCATACACTGGCCCGCGCACTCTAGACGGCAGACCT
GCGCCCGCAGAGTCCCGACAGAGCCCTGCTGCTCGCTCACAAAAGCAATCGCTTGCCAAGAAGAAAGGTGTCGCC
ACCCTGAGCTCCCTTGCTCAGGCTTCAAATGTCGACGATGACGATGACATGTCAGAAAACGAGGATAACAAGGAA
AACCGAGGCAATCTCTTTGCCGGCGGAGAAAAGTCTGGGCTTGCGGTTCAGGATCCGAGCAAGGAGGGCGGATCA
CGAAGCCTCATCAACGATATCATTGCCAAGGCCAAATCCAACTCTTCTCTCACTGAAGGGCCAGAAGCTGGCCCT
TCTAACTCGTCTCGCTTCCAGGGTACGGGAATGACATTGGGTGGAGATGGTCAGGAAAGCCGTGCCATTCCAGAT
ACCTCGAGTCTGGCTCATGGAACAGATGCACCGGTACAGGAACGAGTGCTTCACATTTGGGAAAATGGATTCAGC
ATAGACGACGGCGAGCTACGGCGGTACGATGACCCCGCCAACCAAGCGGATCTAGAAATGATTCGCCAGGAACGA
GCTCCGCTGCACTTGATGAATGTGCAGTACGATCAACCCGTCAAAGTGCGGGTTCTTGACCACGACACGGATTAC
GTTGCACCGCCCAAAAAACAGACCCGTTTCATGGGGAGTGGACAGCGCCTCGGTAGTCCGGTTCCCGGGGCCGGC
TCTTCAACAGCCGTAGCTGATTCAGCGCCAAGGACGACGTCGGCTCCTGCACCAGGGAGTGCGGCATCGTCTGCC
TTTACAGGACCGACTATTGACGAGTCTCAACCAATTGTCACGATTCGTATTCAATTGCCAGATGGAAGACGAGTG
CCTGTACGATTCAACACGTCTCACACAGTCGGTGACATGTACAAGGTGCTGCAGGACGCACACATGGAATTGCTC
AGCTCACGGCCTTGGATCTTGGCGACCACATTTCCCAACAAGGAGCACACGGATAAAAGCCTAGCCTTGGCCAAC
GCGCCCGAGTTTAAGAAGGGAGGCACGGCAGTGGTCAAATGGACAAACTAG
Gene >OphauB2|1727
ATGAGCGAAGCACCGCCTGAAGACAAGCAGAAGCTTGTGGAGCAAGTCTGCGAGACGTGCCAGGTACCCGAGCAA
ATTGTTCGTAGCTACGAAGCTTTATATCCCCCCCGTCGCACCGCTGCAGCAGCTAACTAACCACACTGCAGGCGA
CGCACTATCTCGAAGCCTATAGCTGGGATGGTGAAGCTGCCATTGGAGGCTTCATGGCTGACAACTTTGATGCTG
CAGAGCAGGCTACTGATGAAGCTGCTGAGCCGCCATACACTGGCCCGCGCACTCTAGACGGCAGACCTGCGCCCG
CAGAGTCCCGACAGAGCCCTGCTGCTCGCTCACAAAAGCAATCGCTTGCCAAGAAGAAAGGTGTCGCCACCCTGA
GCTCCCTTGCTCAGGCTTCAAATGTCGACGATGACGATGACATGTCAGAAAACGAGGATAACAAGGAAAACCGAG
GCAATCTCTTTGCCGGCGGAGAAAAGTCTGGGCTTGCGGTTCAGGATCCGAGCAAGGAGGGCGGATCACGAAGCC
TCATCAACGATATCATTGCCAAGGCCAAATCGTGGGTTTTCCAGCTCGTCGTTTTCTTTTTTAACAAGTTTGCGC
TGACAAGGTACAGCAACTCTTCTCTCACTGAAGGGCCAGAAGCTGGCCCTTCTAACTCGTCTCGCTTCCAGGGTA
CGGGAATGACATTGGGTGGAGATGGTCAGGAAAGCCGTGCCATTCCAGATACCTCGAGTCTGGCTCATGGAACAG
ATGCACCGGTACAGGAACGAGTGCTTCACATTTGGGAAAATGGATTCAGCATAGACGACGGCGAGCTACGGCGGT
ACGATGACCCCGCCAACCAAGCGGATCTAGAAATGATTCGCCAGGAACGAGCTCCGCTGCACTTGATGAATGTGC
AGTACGATCAACCCGTCAAAGTGCGGGTTCTTGACCACGACACGGATTACGTTGCACCGCCCAAAAAACAGACCC
GTTTCATGGGGAGTGGACAGCGCCTCGGTAGTCCGGTTCCCGGGGCCGGCTCTTCAACAGCCGTAGCTGATTCAG
CGCCAAGGACGACGTCGGCTCCTGCACCAGGGAGTGCGGCATCGTCTGCCTTTACAGGACCGACTATTGACGAGT
CTCAACCAATTGTCACGATTCGTATTCAATTGCCAGATGGAAGACGAGTGCCTGTACGATTCAACACGTCTCACA
CAGTCGGTGACATGTACAAGGTGCTGCAGGACGCACACATGGAATTGCTCAGCTCACGGCCTTGGATCTTGGCGA
CCACATTTCCCAACAAGGAGCACACGGATAAAAGCCTAGCCTTGGCCAACGCGCCCGAGTTTAAGAAGGGAGGCA
CGGCAGTGGTCAAATGGACAAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail