Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1726
Gene name
LocationContig_15:47400..48580
Strand+
Gene length (bp)1180
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 1.3E-93 33 275
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 4.2E-07 33 139
PF01926 MMR_HSR1 50S ribosome-binding GTPase 4.7E-07 33 131
PF00025 Arf ADP-ribosylation factor family 3.9E-07 28 156
PF00071 Ras Ras family 5.1E-07 33 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q63486|RRAGA_RAT Ras-related GTP-binding protein A OS=Rattus norvegicus GN=Rraga PE=1 SV=1 26 350 1.0E-102
sp|Q80X95|RRAGA_MOUSE Ras-related GTP-binding protein A OS=Mus musculus GN=Rraga PE=1 SV=1 26 350 1.0E-102
sp|Q7L523|RRAGA_HUMAN Ras-related GTP-binding protein A OS=Homo sapiens GN=RRAGA PE=1 SV=1 26 350 1.0E-102
sp|Q3SX43|RRAGA_BOVIN Ras-related GTP-binding protein A OS=Bos taurus GN=RRAGA PE=2 SV=1 26 350 1.0E-102
sp|O74824|GTR1_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr1 PE=3 SV=1 31 340 1.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q63486|RRAGA_RAT Ras-related GTP-binding protein A OS=Rattus norvegicus GN=Rraga PE=1 SV=1 26 350 1.0E-102
sp|Q80X95|RRAGA_MOUSE Ras-related GTP-binding protein A OS=Mus musculus GN=Rraga PE=1 SV=1 26 350 1.0E-102
sp|Q7L523|RRAGA_HUMAN Ras-related GTP-binding protein A OS=Homo sapiens GN=RRAGA PE=1 SV=1 26 350 1.0E-102
sp|Q3SX43|RRAGA_BOVIN Ras-related GTP-binding protein A OS=Bos taurus GN=RRAGA PE=2 SV=1 26 350 1.0E-102
sp|O74824|GTR1_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr1 PE=3 SV=1 31 340 1.0E-98
sp|Q63487|RRAGB_RAT Ras-related GTP-binding protein B OS=Rattus norvegicus GN=RragB PE=1 SV=1 14 350 1.0E-96
sp|Q6NTA4|RRAGB_MOUSE Ras-related GTP-binding protein B OS=Mus musculus GN=Rragb PE=2 SV=1 14 350 1.0E-96
sp|Q5VZM2|RRAGB_HUMAN Ras-related GTP-binding protein B OS=Homo sapiens GN=RRAGB PE=1 SV=1 26 350 1.0E-95
sp|Q54IK1|RRAGA_DICDI Ras-related GTP-binding protein A OS=Dictyostelium discoideum GN=ragA PE=2 SV=1 31 351 1.0E-94
sp|Q00582|GTR1_YEAST GTP-binding protein GTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTR1 PE=1 SV=1 31 284 4.0E-82
sp|P53290|GTR2_YEAST GTP-binding protein GTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTR2 PE=1 SV=1 31 253 8.0E-16
sp|O74544|GTR2_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr2 PE=3 SV=1 30 256 4.0E-12
sp|Q99K70|RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus GN=Rragc PE=1 SV=1 31 256 5.0E-12
sp|Q9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens GN=RRAGC PE=1 SV=1 31 256 6.0E-12
sp|Q9NQL2|RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens GN=RRAGD PE=1 SV=1 20 253 7.0E-10
sp|Q7TT45|RRAGD_MOUSE Ras-related GTP-binding protein D OS=Mus musculus GN=Rragd PE=2 SV=2 20 253 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1726
MASHQHGHHHHHHAPQVAPSEPRSEPKKPKKKKVLLMGKSGSGKSSMRSIIFSNYIARDTRRLGATIDIDLSHVK
FLGNLTLNLWDCGGQEAFMENYLSQQRVHVFSNVGVLIYVFDIESRDVDRDLATYVSILSALLQFSPAARVYILV
HKMDLVVPSAREAVYDERVRVVRQKTLELLVSSSASPAAHSLDLVPFATSIWDQSLYKAWASIIHDLVPNLSVIE
HNLANLGAAIEAEELLLFERTSFLAVSSWTSREGHRNPTEDRLERMSNIMKHFKQTISRYTGTPRNAEQFIRMEH
KAGLRFNLFILKFTTNTYLMVVLPPGEARFNAAMLNCQVAIEHFRFLDGPAAQVPP*
Coding >OphauB2|1726
ATGGCCTCACACCAGCACGGCCACCACCACCACCATCATGCGCCCCAAGTCGCCCCCTCTGAGCCACGCAGCGAG
CCCAAGAAGCCCAAGAAGAAAAAGGTGCTGCTCATGGGAAAGTCTGGCTCGGGCAAGTCGAGTATGCGAAGCATA
ATATTCAGCAACTATATTGCCCGCGACACGCGCCGTCTCGGCGCCACCATTGACATTGATCTCTCCCATGTCAAG
TTTCTCGGCAACTTGACCCTCAATCTCTGGGACTGCGGCGGCCAAGAGGCTTTTATGGAAAACTATCTTTCCCAG
CAGCGTGTCCACGTCTTCTCCAACGTTGGCGTCCTCATCTACGTCTTTGACATTGAATCCCGCGATGTCGACCGC
GATCTCGCCACCTATGTCTCCATCCTCTCGGCCCTTTTGCAATTCTCGCCCGCCGCCCGCGTCTACATCCTCGTC
CACAAGATGGATCTCGTCGTGCCCAGTGCCCGCGAGGCCGTCTATGACGAGCGTGTCCGCGTCGTCCGCCAAAAG
ACGCTCGAGCTTCTCGTTTCCTCGTCGGCCTCGCCTGCCGCCCATTCGCTCGATCTGGTTCCCTTTGCCACGTCC
ATCTGGGACCAGAGCCTCTACAAGGCCTGGGCTTCCATCATTCACGACCTCGTCCCCAATCTCTCCGTCATTGAG
CACAACCTGGCCAATCTCGGCGCCGCCATTGAGGCCGAGGAGCTTCTTCTCTTTGAGCGCACTTCCTTTCTCGCC
GTTTCCTCGTGGACCTCGCGCGAGGGCCACCGCAACCCAACCGAGGACCGTCTCGAGCGCATGTCCAACATCATG
AAACACTTCAAGCAGACCATTTCTCGCTACACTGGCACTCCCCGCAATGCAGAGCAGTTTATCCGCATGGAGCAC
AAGGCCGGTCTTCGCTTCAATCTCTTTATCCTCAAGTTCACCACAAACACCTATCTCATGGTTGTCCTGCCTCCC
GGAGAGGCCCGCTTCAATGCCGCAATGCTCAACTGCCAGGTTGCCATTGAGCACTTTCGTTTTCTCGACGGTCCC
GCCGCCCAGGTTCCCCCTTGA
Transcript >OphauB2|1726
ATGGCCTCACACCAGCACGGCCACCACCACCACCATCATGCGCCCCAAGTCGCCCCCTCTGAGCCACGCAGCGAG
CCCAAGAAGCCCAAGAAGAAAAAGGTGCTGCTCATGGGAAAGTCTGGCTCGGGCAAGTCGAGTATGCGAAGCATA
ATATTCAGCAACTATATTGCCCGCGACACGCGCCGTCTCGGCGCCACCATTGACATTGATCTCTCCCATGTCAAG
TTTCTCGGCAACTTGACCCTCAATCTCTGGGACTGCGGCGGCCAAGAGGCTTTTATGGAAAACTATCTTTCCCAG
CAGCGTGTCCACGTCTTCTCCAACGTTGGCGTCCTCATCTACGTCTTTGACATTGAATCCCGCGATGTCGACCGC
GATCTCGCCACCTATGTCTCCATCCTCTCGGCCCTTTTGCAATTCTCGCCCGCCGCCCGCGTCTACATCCTCGTC
CACAAGATGGATCTCGTCGTGCCCAGTGCCCGCGAGGCCGTCTATGACGAGCGTGTCCGCGTCGTCCGCCAAAAG
ACGCTCGAGCTTCTCGTTTCCTCGTCGGCCTCGCCTGCCGCCCATTCGCTCGATCTGGTTCCCTTTGCCACGTCC
ATCTGGGACCAGAGCCTCTACAAGGCCTGGGCTTCCATCATTCACGACCTCGTCCCCAATCTCTCCGTCATTGAG
CACAACCTGGCCAATCTCGGCGCCGCCATTGAGGCCGAGGAGCTTCTTCTCTTTGAGCGCACTTCCTTTCTCGCC
GTTTCCTCGTGGACCTCGCGCGAGGGCCACCGCAACCCAACCGAGGACCGTCTCGAGCGCATGTCCAACATCATG
AAACACTTCAAGCAGACCATTTCTCGCTACACTGGCACTCCCCGCAATGCAGAGCAGTTTATCCGCATGGAGCAC
AAGGCCGGTCTTCGCTTCAATCTCTTTATCCTCAAGTTCACCACAAACACCTATCTCATGGTTGTCCTGCCTCCC
GGAGAGGCCCGCTTCAATGCCGCAATGCTCAACTGCCAGGTTGCCATTGAGCACTTTCGTTTTCTCGACGGTCCC
GCCGCCCAGGTTCCCCCTTGA
Gene >OphauB2|1726
ATGGCCTCACACCAGCACGGCCACCACCACCACCATCATGCGCCCCAAGTCGCCCCCTCTGAGCCACGCAGCGAG
CCCAAGAAGCCCAAGAAGAAAAAGGTGCTGCTCATGGGAAAGTCTGGCTCGGGCAAGTCGAGTATGCGAAGCATA
ATATTCAGCAACTATATTGCCCGCGACACGCGCCGTCTGTAAGCACTTGGCCAAGAGACCTTTTTCTCTTTCCCT
TCCTCCCTCCATTGTCCTTGCTCGCACCTTGTCCATGTGAGGATGGCAGCTCGTCTTACGCAGCTATTCAAGCGG
CGCCACCATTGACATTGATCTCTCCCATGTCAAGTTTCTCGGCAACTTGACCCTCAATCTCTGGGACTGCGGCGG
CCAAGAGGCTTTTATGGAAAACTATCTTTCCCAGCAGCGTGTCCACGTCTTCTCCAACGTTGGCGTCCTCATCTA
CGTCTTTGACATTGAATCCCGCGATGTCGACCGCGATCTCGCCACCTATGTCTCCATCCTCTCGGCCCTTTTGCA
ATTCTCGCCCGCCGCCCGCGTCTACATCCTCGTCCACAAGATGGATCTCGTCGTGCCCAGTGCCCGCGAGGCCGT
CTATGACGAGCGTGTCCGCGTCGTCCGCCAAAAGACGCTCGAGCTTCTCGTTTCCTCGTCGGCCTCGCCTGCCGC
CCATTCGCTCGATCTGGTTCCCTTTGCCACGTCCATCTGGGACCAGAGCCTCTACAAGGCCTGGGCTTCCATCAT
TCACGACCTCGTCCCCAATCTCTCCGTCATTGAGCACAACCTGGCCAATCTCGGCGCCGCCATTGAGGCCGAGGA
GCTTCTTCTCTTTGAGCGCACTTCCTTTCTCGCCGTTTCCTCGTGGACCTCGCGCGAGGGCCACCGCAACCCAAC
CGAGGACCGTCTCGAGCGCATGTCCAACATCATGAAACACTTCAAGCAGACCATTTCTCGCTACACTGGCACTCC
CCGCAATGCAGAGCAGTTTATCCGCATGGAGCACAAGGCCGGTCTTCGCTTCAATCTCTTTATCCTCAAGTTCAC
CACAAACACCTATCTCATGGTTGTCCTGCCTCCCGGAGAGGCCCGCTTCAATGCCGCAATGCTCAACTGCCAGGT
TGCCATTGAGCACTTTCGTTTTCTCGACGGTCCCGCCGCCCAGGTTCCCCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail