Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1721
Gene name
LocationContig_15:32370..34017
Strand-
Gene length (bp)1647
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 6.1E-23 207 451
PF06155 GBBH-like_N Gamma-butyrobetaine hydroxylase-like, N-terminal 1.1E-05 68 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R5D8|BODG_PONAB Gamma-butyrobetaine dioxygenase OS=Pongo abelii GN=BBOX1 PE=2 SV=1 95 431 2.0E-20
sp|O75936|BODG_HUMAN Gamma-butyrobetaine dioxygenase OS=Homo sapiens GN=BBOX1 PE=1 SV=1 95 431 4.0E-20
sp|P80193|BODG_PSESK Gamma-butyrobetaine dioxygenase OS=Pseudomonas sp. (strain AK-1) PE=1 SV=1 96 466 2.0E-19
sp|Q9QZU7|BODG_RAT Gamma-butyrobetaine dioxygenase OS=Rattus norvegicus GN=Bbox1 PE=1 SV=1 95 431 9.0E-17
sp|Q924Y0|BODG_MOUSE Gamma-butyrobetaine dioxygenase OS=Mus musculus GN=Bbox1 PE=1 SV=1 223 431 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R5D8|BODG_PONAB Gamma-butyrobetaine dioxygenase OS=Pongo abelii GN=BBOX1 PE=2 SV=1 95 431 2.0E-20
sp|O75936|BODG_HUMAN Gamma-butyrobetaine dioxygenase OS=Homo sapiens GN=BBOX1 PE=1 SV=1 95 431 4.0E-20
sp|P80193|BODG_PSESK Gamma-butyrobetaine dioxygenase OS=Pseudomonas sp. (strain AK-1) PE=1 SV=1 96 466 2.0E-19
sp|Q9QZU7|BODG_RAT Gamma-butyrobetaine dioxygenase OS=Rattus norvegicus GN=Bbox1 PE=1 SV=1 95 431 9.0E-17
sp|Q924Y0|BODG_MOUSE Gamma-butyrobetaine dioxygenase OS=Mus musculus GN=Bbox1 PE=1 SV=1 223 431 2.0E-16
sp|P23180|AIM17_YEAST Probable oxidoreductase AIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM17 PE=1 SV=2 111 439 1.0E-15
sp|A5DCB6|TMLH_PICGU Trimethyllysine dioxygenase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00921 PE=3 SV=2 93 469 1.0E-15
sp|Q91ZW6|TMLH_RAT Trimethyllysine dioxygenase, mitochondrial OS=Rattus norvegicus GN=Tmlhe PE=1 SV=2 96 458 1.0E-14
sp|Q9NVH6|TMLH_HUMAN Trimethyllysine dioxygenase, mitochondrial OS=Homo sapiens GN=TMLHE PE=1 SV=1 72 431 2.0E-14
sp|Q96UB1|TMLH_NEUCR Trimethyllysine dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-1 PE=2 SV=2 101 461 3.0E-14
sp|Q91ZE0|TMLH_MOUSE Trimethyllysine dioxygenase, mitochondrial OS=Mus musculus GN=Tmlhe PE=1 SV=2 213 458 1.0E-13
sp|Q0VC74|TMLH_BOVIN Trimethyllysine dioxygenase, mitochondrial OS=Bos taurus GN=TMLHE PE=2 SV=1 213 458 2.0E-13
sp|Q19000|BODG_CAEEL Probable gamma-butyrobetaine dioxygenase OS=Caenorhabditis elegans GN=gbh-1 PE=3 SV=1 172 454 5.0E-13
sp|Q5F4B3|TMLH_CHICK Trimethyllysine dioxygenase, mitochondrial OS=Gallus gallus GN=TMLHE PE=2 SV=1 213 458 6.0E-12
sp|Q98KK0|BODG_RHILO Probable gamma-butyrobetaine dioxygenase OS=Rhizobium loti (strain MAFF303099) GN=mll1440 PE=3 SV=1 223 331 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup218
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2592
Ophiocordyceps australis 1348a (Ghana) OphauG2|2593
Ophiocordyceps australis map64 (Brazil) OphauB2|1721 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1722
Ophiocordyceps camponoti-floridani Ophcf2|05298
Ophiocordyceps camponoti-floridani Ophcf2|05299
Ophiocordyceps camponoti-rufipedis Ophun1|359
Ophiocordyceps kimflemingae Ophio5|2368
Ophiocordyceps kimflemingae Ophio5|2369
Ophiocordyceps subramaniannii Hirsu2|2316
Ophiocordyceps subramaniannii Hirsu2|2317

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1721
MDSGLEETCKEDDFGQKAEEAAGLTAADDKEQDDFWKAERSWRSREDEDALTVPEDAQRIQVNNESFKNMKLMVA
WKDRQVWFMVNELRKNKSRVFEATRIRDNCSCHECRDATSGNKLFTTAEIAPDVAVLNVEEDLRLGLRVTLGSAS
GGEATQHQTMLVWSEVSDLVAPQRQRRVQDTANMEAARRRFMPFFWKRNSVEKEMKTVPWQELQSPKGVWMVLEQ
LTRLGLVVVKDVPQQADAVEQIARLLGPVRETFYGRTFELRAKENADNVAYTRRALPLHQDLLYLNPPPRLQLLH
CYSDGGAPRVPTLFCDAERIGRLLCSLRPRFPVLDPLFVDPVPYQYKANAHYYCNEHPVIDIDWRDQAYRQLWWS
PPFVAPRQISGYSLAPWILVARFISSLFAHKSNMFPLDLESGQCVIFDNWRLLHGRGPLLPPQQAPPAATERLFY
GTYLAAEDFYSAVCNLVEIPSLSVKAKQYTSHISREPDLESIQGLVQQLQAKAEADPGIGLPRSPPTYHELAQMD
RRRGRWRLNGAFSEKNLSAKPDL*
Coding >OphauB2|1721
ATGGATAGCGGGTTGGAGGAGACATGCAAAGAGGACGACTTTGGCCAAAAGGCGGAGGAGGCGGCGGGCTTGACG
GCAGCAGACGACAAGGAACAAGACGACTTTTGGAAAGCTGAGCGTAGTTGGCGATCAAGAGAAGACGAGGACGCC
TTGACAGTGCCAGAGGACGCGCAGCGGATCCAAGTGAATAACGAGTCGTTCAAAAATATGAAGCTAATGGTGGCG
TGGAAGGACAGGCAGGTGTGGTTCATGGTGAATGAGTTGCGCAAGAATAAAAGCCGAGTGTTTGAGGCGACGCGG
ATCCGAGACAACTGTTCATGCCACGAGTGCCGGGACGCGACATCGGGCAACAAGCTGTTTACGACGGCGGAGATT
GCGCCAGACGTGGCGGTGCTGAATGTGGAGGAAGATTTGCGGCTTGGGCTGCGGGTGACGCTTGGCTCAGCGTCG
GGGGGCGAGGCGACGCAGCACCAGACGATGCTAGTGTGGAGCGAGGTGAGCGACTTGGTGGCGCCTCAGCGGCAG
CGGCGCGTGCAGGACACGGCCAACATGGAGGCGGCGCGGCGGCGCTTCATGCCCTTTTTCTGGAAGCGCAACTCG
GTGGAAAAGGAGATGAAGACGGTGCCGTGGCAGGAGCTGCAGAGCCCCAAGGGCGTGTGGATGGTGCTGGAGCAG
TTGACGCGGCTGGGCCTGGTGGTGGTCAAGGATGTGCCGCAGCAGGCCGATGCCGTGGAGCAGATTGCGCGGCTG
CTGGGCCCCGTGCGCGAGACGTTTTACGGCCGCACCTTTGAGCTGCGCGCCAAGGAGAATGCCGACAATGTGGCG
TATACGCGCCGCGCGCTGCCGCTGCACCAGGACCTGCTCTATCTCAATCCGCCGCCGCGCCTCCAGCTGCTGCAC
TGCTACAGCGACGGCGGCGCCCCCCGCGTGCCTACGCTCTTTTGCGACGCCGAGCGCATCGGCCGTCTCTTGTGC
AGCTTGCGCCCCAGATTTCCCGTCCTCGATCCCCTCTTTGTCGACCCCGTGCCCTATCAGTACAAGGCCAACGCC
CACTACTACTGTAACGAGCATCCCGTCATTGACATTGACTGGCGTGACCAGGCCTATCGCCAGCTGTGGTGGAGC
CCGCCCTTTGTCGCCCCCCGGCAAATCTCGGGGTATTCCCTTGCGCCTTGGATCCTCGTGGCCCGCTTCATCTCG
TCCCTCTTTGCCCACAAGTCAAACATGTTTCCCCTCGACCTCGAGTCGGGCCAGTGCGTCATCTTTGACAATTGG
CGCCTCCTCCACGGCCGCGGGCCTCTGCTCCCGCCCCAGCAGGCACCACCAGCCGCCACTGAGCGTCTCTTTTAC
GGCACCTACTTGGCCGCCGAAGACTTTTACAGCGCCGTCTGCAACTTGGTCGAAATCCCTTCCCTCTCAGTCAAG
GCAAAGCAATACACCAGCCACATTTCCCGCGAGCCCGACTTGGAATCCATTCAAGGCCTCGTCCAACAGCTGCAG
GCCAAGGCTGAGGCTGATCCCGGCATTGGCCTGCCCAGATCCCCGCCCACCTACCATGAATTGGCCCAGATGGAT
AGGCGCAGGGGCCGCTGGCGCTTAAACGGCGCTTTTTCCGAAAAGAACCTGTCCGCTAAACCAGACTTGTAA
Transcript >OphauB2|1721
ATGGATAGCGGGTTGGAGGAGACATGCAAAGAGGACGACTTTGGCCAAAAGGCGGAGGAGGCGGCGGGCTTGACG
GCAGCAGACGACAAGGAACAAGACGACTTTTGGAAAGCTGAGCGTAGTTGGCGATCAAGAGAAGACGAGGACGCC
TTGACAGTGCCAGAGGACGCGCAGCGGATCCAAGTGAATAACGAGTCGTTCAAAAATATGAAGCTAATGGTGGCG
TGGAAGGACAGGCAGGTGTGGTTCATGGTGAATGAGTTGCGCAAGAATAAAAGCCGAGTGTTTGAGGCGACGCGG
ATCCGAGACAACTGTTCATGCCACGAGTGCCGGGACGCGACATCGGGCAACAAGCTGTTTACGACGGCGGAGATT
GCGCCAGACGTGGCGGTGCTGAATGTGGAGGAAGATTTGCGGCTTGGGCTGCGGGTGACGCTTGGCTCAGCGTCG
GGGGGCGAGGCGACGCAGCACCAGACGATGCTAGTGTGGAGCGAGGTGAGCGACTTGGTGGCGCCTCAGCGGCAG
CGGCGCGTGCAGGACACGGCCAACATGGAGGCGGCGCGGCGGCGCTTCATGCCCTTTTTCTGGAAGCGCAACTCG
GTGGAAAAGGAGATGAAGACGGTGCCGTGGCAGGAGCTGCAGAGCCCCAAGGGCGTGTGGATGGTGCTGGAGCAG
TTGACGCGGCTGGGCCTGGTGGTGGTCAAGGATGTGCCGCAGCAGGCCGATGCCGTGGAGCAGATTGCGCGGCTG
CTGGGCCCCGTGCGCGAGACGTTTTACGGCCGCACCTTTGAGCTGCGCGCCAAGGAGAATGCCGACAATGTGGCG
TATACGCGCCGCGCGCTGCCGCTGCACCAGGACCTGCTCTATCTCAATCCGCCGCCGCGCCTCCAGCTGCTGCAC
TGCTACAGCGACGGCGGCGCCCCCCGCGTGCCTACGCTCTTTTGCGACGCCGAGCGCATCGGCCGTCTCTTGTGC
AGCTTGCGCCCCAGATTTCCCGTCCTCGATCCCCTCTTTGTCGACCCCGTGCCCTATCAGTACAAGGCCAACGCC
CACTACTACTGTAACGAGCATCCCGTCATTGACATTGACTGGCGTGACCAGGCCTATCGCCAGCTGTGGTGGAGC
CCGCCCTTTGTCGCCCCCCGGCAAATCTCGGGGTATTCCCTTGCGCCTTGGATCCTCGTGGCCCGCTTCATCTCG
TCCCTCTTTGCCCACAAGTCAAACATGTTTCCCCTCGACCTCGAGTCGGGCCAGTGCGTCATCTTTGACAATTGG
CGCCTCCTCCACGGCCGCGGGCCTCTGCTCCCGCCCCAGCAGGCACCACCAGCCGCCACTGAGCGTCTCTTTTAC
GGCACCTACTTGGCCGCCGAAGACTTTTACAGCGCCGTCTGCAACTTGGTCGAAATCCCTTCCCTCTCAGTCAAG
GCAAAGCAATACACCAGCCACATTTCCCGCGAGCCCGACTTGGAATCCATTCAAGGCCTCGTCCAACAGCTGCAG
GCCAAGGCTGAGGCTGATCCCGGCATTGGCCTGCCCAGATCCCCGCCCACCTACCATGAATTGGCCCAGATGGAT
AGGCGCAGGGGCCGCTGGCGCTTAAACGGCGCTTTTTCCGAAAAGAACCTGTCCGCTAAACCAGACTTGTAA
Gene >OphauB2|1721
ATGGATAGCGGGTTGGAGGAGACATGCAAAGAGGACGACTTTGGCCAAAAGGCGGAGGAGGCGGCGGGCTTGACG
GCAGCAGACGACAAGGAACAAGACGACTTTTGGAAAGCTGAGCGTAGTTGGCGATCAAGAGAAGACGAGGACGCC
TTGACAGTGCCAGAGGACGCGCAGCGGATCCAAGTGAATAACGAGTCGTTCAAAAATATGAAGCTAATGGTGGCG
TGGAAGGACAGGCAGGTGTGGTTCATGGTGAATGAGTTGCGCAAGAATAAAAGCCGAGTGTTTGAGGCGACGCGG
ATCCGAGACAACTGTTCATGCCACGAGTGCCGGGACGCGACATCGGGCAACAAGCTGTTTACGACGGCGGAGATT
GCGCCAGACGTGGCGGTGCTGAATGTGGAGGAAGATTTGCGGCTTGGGCTGCGGGTGACGCTTGGCTCAGCGTCG
GGGGGCGAGGCGACGCAGCACCAGACGATGCTAGTGTGGAGCGAGGTGAGCGACTTGGTGGCGCCTCAGCGGCAG
CGGCGCGTGCAGGACACGGCCAACATGGAGGCGGCGCGGCGGCGCTTCATGCCCTTTTTCTGGAAGCGCAACTCG
GTGGAAAAGGAGATGAAGACGGTGCCGTGGCAGGAGCTGCAGAGCCCCAAGGGCGTGTGGATGGTGCTGGAGCAG
TTGACGCGGCTGGGCCTGGTGGTGGTCAAGGATGTGCCGCAGCAGGCCGATGCCGTGGAGCAGATTGCGCGGCTG
CTGGGCCCCGTGCGCGAGACGTTTTACGGCCGCACCTTTGAGCTGCGCGCCAAGGAGAATGCCGACAATGTGGCG
TATACGCGCCGCGCGCTGCCGCTGCACCAGGACCTGCTCTATCTCAATCCGCCGCCGCGCCTCCAGCTGCTGCAC
TGCTACAGCGACGGCGGCGCCCCCCGCGTGCCTACGCTCTTTTGCGACGCCGAGCGCATCGGCCGTCTCTTGTGC
AGCTTGCGCCCCAGATTTCCCGTCCTCGATCCCCTCTTTGTCGACCCCGTGCCCTATCAGTACAAGGCCAACGCC
CACTACTACTGTAACGAGCATCCCGTCATTGACATTGACTGGCGTGACCAGGCCTATCGCCAGCTGTGGTGGAGC
CCGCCCTTTGTCGCCCCCCGGCAAATCTCGGGGTATTCCCTTGCGCCTTGGATCCTCGTGGCCCGCTTCATCTCG
TCCCTCTTTGCCCACAAGTCAAACATGTTTCCCCTCGACCTCGAGTCGGGCCAGTGCGTCATCTTTGACAATTGG
CGCCTCCTCCACGGCCGCGGGCCTCTGCTCCCGCCCCAGCAGGCACCACCAGCCGCCACTGAGCGTCTCTTTTAC
GGCACCTACTTGGCCGCCGAAGACTTTTACAGCGCCGTCTGCAACTTGGTCGAAATCCCTTCCCTCTCAGTCAAG
GCAAAGCAATACACCAGCCACATTTCCCGCGAGCCCGACTTGGAATCCATTCAAGGCCTCGTCCAACAGCTGCAG
GCCAAGGCTGAGGCTGATCCCGGCATTGGCCTGCCCAGATCCCCGCCCACCTACCATGAATTGGCCCAGATGGAT
AGGCGCAGGGGCCGCTGGCGCTTAAACGGCGCTTTTTCCGAAAAGAACCTGTCCGCTAAACCAGACTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail