Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1719
Gene name
LocationContig_15:27411..29926
Strand+
Gene length (bp)2515
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13243 SQHop_cyclase_C Squalene-hopene cyclase C-terminal domain 2.4E-44 402 732
PF13249 SQHop_cyclase_N Squalene-hopene cyclase N-terminal domain 1.1E-34 98 387
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 1.0E+01 96 127
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 5.1E-07 139 179
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 1.1E-09 575 615
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 2.1E-06 626 671

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10231|ERG7_SCHPO Lanosterol synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg7 PE=2 SV=1 22 736 0.0E+00
sp|Q96WJ0|ERG7_PNECA Lanosterol synthase OS=Pneumocystis carinii GN=ERG7 PE=2 SV=1 32 739 0.0E+00
sp|P48450|ERG7_RAT Lanosterol synthase OS=Rattus norvegicus GN=Lss PE=1 SV=2 11 738 0.0E+00
sp|B0Y5B4|PDSA_ASPFC Protostadienol synthase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pdsA PE=3 SV=1 30 733 0.0E+00
sp|Q4WR16|PDSA_ASPFU Protostadienol synthase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pdsA PE=1 SV=1 30 733 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10231|ERG7_SCHPO Lanosterol synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg7 PE=2 SV=1 22 736 0.0E+00
sp|Q96WJ0|ERG7_PNECA Lanosterol synthase OS=Pneumocystis carinii GN=ERG7 PE=2 SV=1 32 739 0.0E+00
sp|P48450|ERG7_RAT Lanosterol synthase OS=Rattus norvegicus GN=Lss PE=1 SV=2 11 738 0.0E+00
sp|B0Y5B4|PDSA_ASPFC Protostadienol synthase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pdsA PE=3 SV=1 30 733 0.0E+00
sp|Q4WR16|PDSA_ASPFU Protostadienol synthase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pdsA PE=1 SV=1 30 733 0.0E+00
sp|Q8BLN5|ERG7_MOUSE Lanosterol synthase OS=Mus musculus GN=Lss PE=1 SV=2 11 738 0.0E+00
sp|P48449|ERG7_HUMAN Lanosterol synthase OS=Homo sapiens GN=LSS PE=1 SV=1 11 738 0.0E+00
sp|P84466|ERG7_BOVIN Lanosterol synthase OS=Bos taurus GN=LSS PE=1 SV=2 11 738 0.0E+00
sp|Q55D85|CAS1_DICDI Cycloartenol synthase OS=Dictyostelium discoideum GN=cas1 PE=1 SV=1 36 741 0.0E+00
sp|P38604|ERG7_YEAST Lanosterol synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG7 PE=1 SV=6 32 736 0.0E+00
sp|Q04782|ERG7_CANAL Lanosterol synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG7 PE=3 SV=1 32 736 0.0E+00
sp|A1CVK0|PDSA_NEOFI Protostadienol synthase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pdsA PE=3 SV=1 30 733 0.0E+00
sp|E4V6I8|PDSA_ARTGP Protostadienol synthase A OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=PDSA PE=3 SV=1 30 736 1.0E-178
sp|P38605|CAS1_ARATH Cycloartenol synthase OS=Arabidopsis thaliana GN=CAS1 PE=1 SV=2 93 732 3.0E-168
sp|Q9SXV6|CAS1_GLYGL Cycloartenol synthase OS=Glycyrrhiza glabra GN=GgCAS1 PE=1 SV=1 94 735 4.0E-168
sp|Q6Z2X6|CAS_ORYSJ Cycloartenol synthase OS=Oryza sativa subsp. japonica GN=Os02g0139700 PE=1 SV=1 87 735 1.0E-167
sp|O82139|CAS1_PANGI Cycloartenol Synthase OS=Panax ginseng GN=OSCPNX1 PE=1 SV=1 94 735 2.0E-167
sp|Q8W3Z3|CAS2_BETPL Cycloartenol synthase 2 OS=Betula platyphylla GN=CASBPX2 PE=1 SV=1 94 735 1.0E-165
sp|Q8W3Z4|CAS1_BETPL Cycloartenol synthase OS=Betula platyphylla GN=CASBPX1 PE=1 SV=1 93 735 1.0E-164
sp|Q6BE23|OXSC_CUCPE Probable oxidosqualene cyclase OS=Cucurbita pepo GN=CPR PE=2 SV=1 93 732 7.0E-161
sp|Q2XPU6|CAS1_RICCO Cycloartenol synthase OS=Ricinus communis PE=1 SV=1 94 735 1.0E-160
sp|E2IUB0|CASS_KALDA Cycloartenol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 88 732 2.0E-159
sp|Q6BE24|CUCS_CUCPE Cucurbitadienol synthase OS=Cucurbita pepo GN=CPQ PE=1 SV=1 94 735 2.0E-159
sp|Q6BE25|CAS1_CUCPE Cycloartenol synthase OS=Cucurbita pepo GN=CPX PE=1 SV=1 94 735 9.0E-156
sp|Q9SLP9|CAS1_LUFAE Cycloartenol synthase OS=Luffa aegyptiaca GN=CAS1 PE=1 SV=1 94 735 2.0E-155
sp|E7DN63|BAMS_SOLLC Beta-amyrin synthase OS=Solanum lycopersicum GN=TTS1 PE=1 SV=1 89 734 3.0E-154
sp|Q9MB42|BAMS_GLYGL Beta-amyrin synthase OS=Glycyrrhiza glabra GN=GgbAS1 PE=1 SV=1 84 737 2.0E-151
sp|O82146|BAMS2_PANGI Beta-Amyrin Synthase 2 OS=Panax ginseng GN=OSCPNY2 PE=2 SV=1 93 741 3.0E-150
sp|A8CDT2|BAS_BRUGY Beta-amyrin synthase OS=Bruguiera gymnorhiza GN=BAS PE=1 SV=1 84 737 6.0E-150
sp|P0C8Y0|LUP3_ARATH Camelliol C synthase OS=Arabidopsis thaliana GN=CAMS1 PE=1 SV=1 88 737 2.0E-149
sp|Q8W3Z1|BAMS_BETPL Beta-amyrin synthase OS=Betula platyphylla GN=OSCBPY PE=1 SV=1 84 737 1.0E-148
sp|E2IUA9|LUPS_KALDA Lupeol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 89 744 4.0E-148
sp|Q9LRH8|BAMS_PEA Beta-amyrin synthase OS=Pisum sativum GN=OSCPSY PE=2 SV=1 93 737 8.0E-148
sp|O82140|BAMS1_PANGI Beta-Amyrin Synthase 1 OS=Panax ginseng GN=OSCPNY1 PE=1 SV=1 93 737 9.0E-148
sp|E2IUA8|FRIES_KALDA Friedelin synthase OS=Kalanchoe daigremontiana PE=1 SV=1 89 734 2.0E-147
sp|A8C980|GERS_RHISY Germanicol synthase OS=Rhizophora stylosa GN=M1 PE=1 SV=1 84 737 7.0E-147
sp|E7DN64|DAMS_SOLLC Delta-amyrin synthase OS=Solanum lycopersicum GN=TTS2 PE=1 SV=1 89 734 7.0E-146
sp|Q8RWT0|LUP2_ARATH Amyrin synthase LUP2 OS=Arabidopsis thaliana GN=LUP2 PE=1 SV=1 84 734 2.0E-144
sp|E2IUA6|TARS_KALDA Taraxerol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 89 737 2.0E-144
sp|B6EXY6|LUP4_ARATH Beta-amyrin synthase OS=Arabidopsis thaliana GN=BAS PE=1 SV=2 89 735 1.0E-142
sp|E2IUA7|GLUTS_KALDA Glutinol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 89 734 1.0E-142
sp|F8WQD0|SHS1_ASTTA Shionone synthase OS=Aster tataricus GN=SHS1 PE=1 SV=1 94 735 3.0E-142
sp|Q2R712|ACBSY_ORYSJ Achilleol B synthase OS=Oryza sativa subsp. japonica GN=Os11g0285000 PE=1 SV=1 87 735 9.0E-142
sp|B9X0J1|STBOS_STERE Baccharis oxide synthase OS=Stevia rebaudiana PE=1 SV=1 100 735 1.0E-141
sp|Q8W3Z2|LUPS_BETPL Lupeol synthase OS=Betula platyphylla GN=OSCBPW PE=1 SV=1 94 735 4.0E-140
sp|Q9LRH7|ABAMS_PEA Mixed-amyrin synthase OS=Pisum sativum GN=OSCPSM PE=1 SV=1 100 735 6.0E-140
sp|Q2XPU7|LUPS_RICCO Lupeol synthase OS=Ricinus communis PE=1 SV=1 89 734 2.0E-139
sp|Q9C5M3|LUP1_ARATH Lupeol synthase 1 OS=Arabidopsis thaliana GN=LUP1 PE=1 SV=1 88 734 8.0E-138
sp|A8CDT3|LUPS_BRUGY Lupeol synthase OS=Bruguiera gymnorhiza GN=LUS PE=1 SV=1 89 737 2.0E-136
sp|Q1G1A4|LAS1_ARATH Lanosterol synthase OS=Arabidopsis thaliana GN=LAS1 PE=2 SV=1 94 734 3.0E-136
sp|Q9FZI2|LUP5_ARATH Lupeol synthase 5 OS=Arabidopsis thaliana GN=LUP5 PE=2 SV=1 84 734 4.0E-136
sp|Q9SYN1|PEN6_ARATH Seco-amyrin synthase OS=Arabidopsis thaliana GN=PEN6 PE=1 SV=1 89 734 2.0E-132
sp|Q948R6|IMFS_LUFAE Isomultiflorenol synthase OS=Luffa aegyptiaca GN=IMS1 PE=1 SV=1 87 737 2.0E-132
sp|H2KWF1|PAKSY_ORYSJ Parkeol synthase OS=Oryza sativa subsp. japonica GN=Os11g0189600 PE=1 SV=1 99 735 9.0E-132
sp|Q9FI37|PEN4_ARATH Thalianol synthase OS=Arabidopsis thaliana GN=THAS1 PE=1 SV=2 67 729 1.0E-129
sp|Q764T8|LUPS_GLYGL Lupeol synthase OS=Glycyrrhiza glabra GN=LUS1 PE=1 SV=1 94 735 6.0E-129
sp|Q9LVY2|PEN3_ARATH Tirucalladienol synthase OS=Arabidopsis thaliana GN=PEN3 PE=1 SV=2 93 734 5.0E-126
sp|O23390|BARS1_ARATH Baruol synthase OS=Arabidopsis thaliana GN=BARS1 PE=1 SV=2 89 734 7.0E-125
sp|A8C981|TARS_RHISY Taraxerol synthase OS=Rhizophora stylosa GN=M2 PE=2 SV=1 88 732 3.0E-122
sp|Q9FR95|PEN1_ARATH Arabidiol synthase OS=Arabidopsis thaliana GN=PEN1 PE=1 SV=1 89 734 6.0E-122
sp|Q08IT1|DADIS_PANGI Dammarenediol II synthase OS=Panax ginseng GN=PNA PE=1 SV=1 89 735 2.0E-121
sp|Q9LS68|PEN7_ARATH Putative pentacyclic triterpene synthase 7 OS=Arabidopsis thaliana GN=PEN7 PE=5 SV=3 93 734 1.0E-120
sp|Q9FJV8|PEN5_ARATH Marneral synthase OS=Arabidopsis thaliana GN=MRN1 PE=1 SV=1 89 733 1.0E-118
sp|P55348|SQHC_RHISN Probable squalene--hopene cyclase OS=Rhizobium sp. (strain NGR234) GN=shc PE=3 SV=1 105 732 5.0E-34
sp|P33990|SQHC_ZYMMO Squalene--hopene cyclase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=shc PE=3 SV=2 101 732 7.0E-33
sp|P54924|SQHC_BRADU Squalene--hopene cyclase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=shc PE=3 SV=2 100 732 4.0E-28
sp|P33247|SQHC_ALIAD Squalene--hopene cyclase OS=Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / JCM 5260 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-1A) GN=shc PE=1 SV=4 139 734 1.0E-26
sp|B3Y522|DCD_DRYCA Dammaradiene synthase OS=Dryopteris crassirhizoma GN=DCD PE=1 SV=1 76 735 8.0E-24
sp|Q796C3|SQHC_BACSU Sporulenol synthase OS=Bacillus subtilis (strain 168) GN=sqhC PE=1 SV=1 144 732 7.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1719
MASPTGRDVPGTQSRRRAKLPQPQKALVLEAKTDRSRWRLKDDDSHHTWHYLAAPEAAQATPQTYAEKYFLNLPL
GLPDLARPKKPLDAAMNGLEFFEKLQLPSGHWACEYGGPMFLVPGIVFTWYATKTPIPSAYATEIKNYIFARAHP
DDGGWGLHCEGKSTVFGTSLNYATLRLIGVEAEHPAMVKARGTLHKLGGATHAPHWAKSWLAIIGIADWDIVNPV
PPELWLLPDWMPFAPWRWWVHIRQVFLPMGYLYSKRWSAPETPLIRALREEMFVQPYADIKWARHRNSISAVDND
YPKTWLLNTANWLIVNVWNPYLRLNVIKDKAEAWSSQLVDMEDANTDFGDLAPVNAPMNALVCYARDGPDAYSVK
RHIERLDEYMWMNRDGMLCNGTNGVQCWDTAFAIQAVFACGLEHQERWRRMLQQAHGYLDRQQIRQNCHDMDKCY
RQVRKGGWPFSTGDQGYAVSDCISEALKSVILLQKKGGFAQLLDDRRIFDAIDTLLLYQNANGALSSYEARRGSE
YLELLNAAEVFGRIMIEYDYTECTTACVTAVTLFNHYWPKYRADEIRVFIERATSWIKTVQRPDGSWYGNWGICF
TYGTMFALESMASIGETYSNSSVSKAGCQFLLSKQRSDGGWSESYKACETMQYHEHPSGSLVVQTAWAVLGLLYA
EYPHVEPLARAIGFLMKRQQANGEWLPEAIEGVFNKSCMITYPNYKFNFTLKALGMFARRYPEVEVEAA*
Coding >OphauB2|1719
ATGGCGAGTCCAACGGGCCGCGACGTGCCTGGGACCCAGTCTCGTAGACGCGCCAAATTACCGCAGCCCCAAAAG
GCGCTCGTCCTTGAGGCCAAGACGGACCGCTCGCGATGGAGGCTCAAAGACGACGATAGCCACCACACTTGGCAT
TATCTGGCTGCCCCCGAGGCTGCTCAGGCCACTCCCCAGACCTATGCGGAAAAGTATTTTTTGAACTTGCCTCTG
GGCCTGCCCGACCTTGCGCGACCCAAGAAGCCACTCGACGCAGCCATGAATGGCTTGGAGTTTTTTGAGAAGCTG
CAGCTCCCATCGGGCCACTGGGCATGCGAGTACGGAGGGCCCATGTTCCTGGTTCCAGGCATCGTCTTTACATGG
TATGCCACCAAGACGCCCATTCCCTCTGCCTACGCCACCGAGATCAAAAACTACATTTTTGCGCGCGCCCACCCC
GACGACGGCGGCTGGGGCCTTCACTGCGAGGGCAAGAGCACGGTATTCGGAACTAGCCTCAACTATGCCACCCTG
CGCCTCATTGGCGTCGAGGCGGAGCACCCAGCCATGGTCAAGGCTCGCGGCACCTTGCACAAGCTGGGTGGCGCC
ACTCATGCCCCTCATTGGGCCAAGAGCTGGCTGGCTATCATCGGCATCGCCGACTGGGACATTGTCAATCCCGTG
CCCCCAGAGCTGTGGCTATTACCCGACTGGATGCCCTTTGCACCCTGGCGCTGGTGGGTGCACATTCGTCAGGTC
TTTCTACCCATGGGCTACCTCTACTCTAAAAGATGGAGCGCCCCGGAAACTCCCCTCATTCGCGCCCTCAGGGAG
GAAATGTTTGTCCAACCATATGCCGACATCAAGTGGGCGCGCCACCGCAACAGCATCTCTGCTGTCGACAATGAC
TATCCAAAGACGTGGCTCCTCAACACGGCCAATTGGCTCATTGTCAATGTTTGGAACCCATATCTTCGACTCAAT
GTCATCAAGGACAAGGCCGAGGCCTGGTCCAGCCAATTGGTGGACATGGAAGACGCCAACACGGACTTTGGAGAC
TTGGCTCCCGTCAATGCTCCAATGAACGCCTTGGTGTGCTATGCGCGGGACGGCCCAGACGCCTATAGCGTCAAG
CGACACATTGAGCGATTGGATGAGTATATGTGGATGAACCGCGACGGCATGCTTTGCAACGGCACCAATGGCGTG
CAGTGCTGGGACACGGCCTTTGCTATCCAAGCCGTCTTTGCCTGCGGGCTGGAGCACCAGGAGCGCTGGAGGCGC
ATGCTGCAACAGGCGCACGGCTACCTTGACCGGCAGCAGATTCGCCAAAACTGCCACGACATGGACAAGTGCTAC
CGACAGGTGCGCAAGGGAGGCTGGCCATTTAGCACTGGCGACCAGGGATACGCGGTGAGCGATTGCATCTCGGAA
GCCCTAAAGTCGGTTATCCTGCTCCAGAAGAAGGGAGGCTTTGCACAGCTGCTCGACGACCGACGCATCTTTGAT
GCCATTGATACCCTGCTGCTATATCAAAACGCCAATGGCGCCTTGTCGTCATACGAAGCACGGCGCGGCAGCGAG
TACCTGGAACTACTAAACGCAGCCGAAGTATTTGGGCGCATCATGATTGAGTACGACTATACAGAGTGCACGACG
GCCTGTGTGACAGCCGTGACGCTATTCAACCACTACTGGCCAAAGTACCGGGCCGATGAGATCCGCGTCTTTATC
GAGAGAGCGACGAGCTGGATCAAGACGGTGCAGCGGCCTGATGGCAGTTGGTACGGCAACTGGGGCATCTGCTTC
ACCTACGGCACCATGTTTGCGCTCGAGAGCATGGCGAGCATTGGCGAGACGTATTCGAATAGCAGTGTGTCCAAG
GCAGGCTGCCAATTCCTCTTGTCCAAGCAGCGCTCCGACGGAGGCTGGTCTGAGAGTTACAAGGCCTGCGAGACG
ATGCAGTATCACGAGCACCCTTCAGGGTCACTGGTAGTGCAAACGGCATGGGCCGTGCTCGGACTTTTGTATGCC
GAGTACCCCCATGTTGAGCCACTTGCAAGAGCAATTGGCTTTTTGATGAAGCGGCAGCAGGCCAATGGCGAGTGG
CTGCCGGAAGCCATTGAGGGTGTCTTCAACAAGTCGTGCATGATTACGTATCCCAACTACAAGTTTAACTTTACG
TTGAAGGCGCTGGGCATGTTTGCCAGGCGGTATCCCGAAGTTGAGGTGGAGGCGGCATAG
Transcript >OphauB2|1719
ATGGCGAGTCCAACGGGCCGCGACGTGCCTGGGACCCAGTCTCGTAGACGCGCCAAATTACCGCAGCCCCAAAAG
GCGCTCGTCCTTGAGGCCAAGACGGACCGCTCGCGATGGAGGCTCAAAGACGACGATAGCCACCACACTTGGCAT
TATCTGGCTGCCCCCGAGGCTGCTCAGGCCACTCCCCAGACCTATGCGGAAAAGTATTTTTTGAACTTGCCTCTG
GGCCTGCCCGACCTTGCGCGACCCAAGAAGCCACTCGACGCAGCCATGAATGGCTTGGAGTTTTTTGAGAAGCTG
CAGCTCCCATCGGGCCACTGGGCATGCGAGTACGGAGGGCCCATGTTCCTGGTTCCAGGCATCGTCTTTACATGG
TATGCCACCAAGACGCCCATTCCCTCTGCCTACGCCACCGAGATCAAAAACTACATTTTTGCGCGCGCCCACCCC
GACGACGGCGGCTGGGGCCTTCACTGCGAGGGCAAGAGCACGGTATTCGGAACTAGCCTCAACTATGCCACCCTG
CGCCTCATTGGCGTCGAGGCGGAGCACCCAGCCATGGTCAAGGCTCGCGGCACCTTGCACAAGCTGGGTGGCGCC
ACTCATGCCCCTCATTGGGCCAAGAGCTGGCTGGCTATCATCGGCATCGCCGACTGGGACATTGTCAATCCCGTG
CCCCCAGAGCTGTGGCTATTACCCGACTGGATGCCCTTTGCACCCTGGCGCTGGTGGGTGCACATTCGTCAGGTC
TTTCTACCCATGGGCTACCTCTACTCTAAAAGATGGAGCGCCCCGGAAACTCCCCTCATTCGCGCCCTCAGGGAG
GAAATGTTTGTCCAACCATATGCCGACATCAAGTGGGCGCGCCACCGCAACAGCATCTCTGCTGTCGACAATGAC
TATCCAAAGACGTGGCTCCTCAACACGGCCAATTGGCTCATTGTCAATGTTTGGAACCCATATCTTCGACTCAAT
GTCATCAAGGACAAGGCCGAGGCCTGGTCCAGCCAATTGGTGGACATGGAAGACGCCAACACGGACTTTGGAGAC
TTGGCTCCCGTCAATGCTCCAATGAACGCCTTGGTGTGCTATGCGCGGGACGGCCCAGACGCCTATAGCGTCAAG
CGACACATTGAGCGATTGGATGAGTATATGTGGATGAACCGCGACGGCATGCTTTGCAACGGCACCAATGGCGTG
CAGTGCTGGGACACGGCCTTTGCTATCCAAGCCGTCTTTGCCTGCGGGCTGGAGCACCAGGAGCGCTGGAGGCGC
ATGCTGCAACAGGCGCACGGCTACCTTGACCGGCAGCAGATTCGCCAAAACTGCCACGACATGGACAAGTGCTAC
CGACAGGTGCGCAAGGGAGGCTGGCCATTTAGCACTGGCGACCAGGGATACGCGGTGAGCGATTGCATCTCGGAA
GCCCTAAAGTCGGTTATCCTGCTCCAGAAGAAGGGAGGCTTTGCACAGCTGCTCGACGACCGACGCATCTTTGAT
GCCATTGATACCCTGCTGCTATATCAAAACGCCAATGGCGCCTTGTCGTCATACGAAGCACGGCGCGGCAGCGAG
TACCTGGAACTACTAAACGCAGCCGAAGTATTTGGGCGCATCATGATTGAGTACGACTATACAGAGTGCACGACG
GCCTGTGTGACAGCCGTGACGCTATTCAACCACTACTGGCCAAAGTACCGGGCCGATGAGATCCGCGTCTTTATC
GAGAGAGCGACGAGCTGGATCAAGACGGTGCAGCGGCCTGATGGCAGTTGGTACGGCAACTGGGGCATCTGCTTC
ACCTACGGCACCATGTTTGCGCTCGAGAGCATGGCGAGCATTGGCGAGACGTATTCGAATAGCAGTGTGTCCAAG
GCAGGCTGCCAATTCCTCTTGTCCAAGCAGCGCTCCGACGGAGGCTGGTCTGAGAGTTACAAGGCCTGCGAGACG
ATGCAGTATCACGAGCACCCTTCAGGGTCACTGGTAGTGCAAACGGCATGGGCCGTGCTCGGACTTTTGTATGCC
GAGTACCCCCATGTTGAGCCACTTGCAAGAGCAATTGGCTTTTTGATGAAGCGGCAGCAGGCCAATGGCGAGTGG
CTGCCGGAAGCCATTGAGGGTGTCTTCAACAAGTCGTGCATGATTACGTATCCCAACTACAAGTTTAACTTTACG
TTGAAGGCGCTGGGCATGTTTGCCAGGCGGTATCCCGAAGTTGAGGTGGAGGCGGCATAG
Gene >OphauB2|1719
ATGGCGAGTCCAACGGGCCGCGACGTGCCTGGGACCCAGTCTCGTAGACGCGCCAAATTACCGCAGCCCCAAAAG
GCGCTCGTCCTTGAGGCCAAGACGGACCGCTCGCGATGGAGGCTCAAAGACGACGATAGCCACCACACTTGGCAT
TATCTGGCTGCCCCCGAGGCTGCTCAGGCCACTCCCCAGACCTATGCGGAAAAGTATTTTTTGAACTTGCCTCTG
GTACGACCACTGTTCCCTATTACACGCCCAGCTTGTCTCCTCAAAGCTGGCTTGTCCTGTCCAGCCCAGCCCTTG
AGTTTGTCTCCCCACACGCGCTGCCATGTCACTGAGCTCACGATATCTCGTCTGTATTATAGGGCCTGCCCGACC
TTGCGCGACCCAAGAAGCCACTCGACGCAGCCATGAATGGCTTGGAGTTTTTTGAGAAGCTGCAGCTCCCATCGG
GCCACTGGGCATGCGAGTACGGAGGGCCCATGTTCCTGGTTCCAGGCATCGTCTTTACATGGTATGCCACCAAGA
CGCCCATTCCCTCTGCCTACGCCACCGAGATCAAAAACTACATTTTTGCGCGCGCCCACCCCGACGACGGCGGCT
GGGGCCTTCACTGCGAGGGCAAGAGCACGGTATTCGGAACTAGCCTCAACTATGCCACCCTGCGCCTCATTGGCG
TCGAGGCGGAGCACCCAGCCATGGTCAAGGCTCGCGGCACCTTGCACAAGCTGGGTGGCGCCACTCATGCCCCTC
ATTGGGCCAAGAGCTGGCTGGCTATCATCGGCATCGCCGACTGGGACATTGTCAATCCCGTGCCCCCAGAGCTGT
GGCTATTACCCGACTGGATGCCCTTTGCACCCTGGCGCTGGTGGGTGCACATTCGTCAGGTCTTTCTACCCATGG
GCTACCTCTACTCTAAAAGATGGAGCGCCCCGGAAACTCCCCTCATTCGCGCCCTCAGGGAGGAAATGTTTGTCC
AACCATATGCCGACATCAAGTGGGCGCGCCACCGCAACAGCATCTCTGCTGTCGACAATGACTATCCAAAGACGT
GGCTCCTCAACACGGCCAATTGGCTCATTGTCAATGTTTGGAACCCATATCTTCGACTCAATGTCATCAAGGACA
AGGCCGAGGCCTGGTCCAGCCAATTGGTGGACATGGAAGACGCCAACACGGACTTTGGAGACTTGGCTCCCGTCA
ATGCTCCAATGAACGCCTTGGTGTGCTATGCGCGGGACGGCCCAGACGCCTATAGCGTCAAGCGACACATTGAGC
GATTGGATGAGTATATGTGGATGAACCGCGACGGCATGCTTTGCAACGGCACCAATGGCGTGCAGTGCTGGGACA
CGGCCTTTGCTATCCAAGCCGTCTTTGCCTGCGGGCTGGAGCACCAGGAGCGCTGGAGGCGCATGCTGCAACAGG
CGCACGGCTACCTTGACCGGCAGCAGATTCGCCAAAACTGCCACGACATGGACAAGTGCTACCGACAGGTGCGCA
AGGGAGGCTGGCCATTTAGCACTGGCGACCAGGGATACGCGGTGAGCGATTGCATCTCGGAAGCCCTAAAGTCGG
TTATCCTGCTCCAGAAGAAGGGAGGCTTTGCACAGCTGCTCGACGACCGACGCATCTTTGATGCCATTGATACCC
TGCTGCTATATCAAAACGCCAATGGCGCCTTGTCGTCATACGAAGCACGGCGCGGCAGCGAGTACCTGGAACTAC
TAAACGCAGCCGAAGTATTTGGGCGCATCATGATTGAGTACGACTATACAGAGTGCACGACGGCCTGTGTGACAG
CCGTGACGCTATTCAACCACTACTGGCCAAAGTACCGGGCCGATGAGATCCGCGTCTTTATCGAGAGAGCGACGA
GCTGGATCAAGACGGTGCAGCGGCCTGATGGCAGTTGGTACGGCAACTGGGGCATCTGCTTCACCTACGGCACCA
TGTTTGCGCTCGAGAGCATGGCGAGCATTGGCGAGACGTATTCGAATAGCAGTGTGTCCAAGGCAGGCTGCCAAT
TCCTCTTGTCCAAGCAGCGCTCCGACGGAGGCTGGTCTGAGAGTTACAAGGTACCGAGAAAGCCTTTTTATTTTC
TATTTTTTTACCCCCCCCCCATTCCTAGAGTTTAAGATTTTTGGGTTATTTTGTCGTTTTTGGGTTATTTTTGTT
TATTTCAAGTGGATAAACTGACAATGCGACACGATGACGACAGGCCTGCGAGACGATGCAGTATCACGAGCACCC
TTCAGGGTCACTGGTAGTGCAAACGGCATGGGCCGTGCTCGGACTTTTGTATGCCGAGTACCCCCATGTTGAGCC
ACTTGCAAGAGCAATTGGCTTTTTGATGAAGCGGCAGCAGGCCAATGGCGAGTGGCTGCCGGAAGCCATTGAGGG
TGTCTTCAACAAGTCGTGCATGATTACGTATCCCAACTACAAGTTTAACTTTACGTTGAAGGCGCTGGGCATGTT
TGCCAGGCGGTATCCCGAAGTTGAGGTGGAGGCGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail